Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 1 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to HNRPA1 (heterogeneous nuclear ribonucleoprotein A1) The peptide sequence was selected from the N terminal of HNRPA1.
Peptide sequence MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | HNRNPA1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 1 mg/ml |
Purity | Protein A purified |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Emily Meredith |
WB | Human | 02/07/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for hnRNP A1 Antibody (NBP1-57121)Find related products by research area.
|
hnRNP A1 - a ribonucleoprotein regulating gene expression at many levels Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) is an abundant ubiquitously expressed protein with important roles in the regulation of gene expression. hnRNP A1 is involved in transcription as well as the splicing, trafficking, and translati... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.