HNF-6/ONECUT1 Antibody - BSA Free

Western Blot: HNF-6/ONECUT1 Antibody [NBP1-91607] - Mouse Liver Lysate 1.0 ug/ml, gel concentration 12%

Immunohistochemistry-Frozen: HNF-6/ONECUT1 Antibody [NBP1-91607] - Frozen section of mouse embryo at et12.5 Primary Dilution: 1:500 Secondary Dilution: 1:2000 Antigen Retrevial method: Citrate buffer (pH=6)

Immunohistochemistry-Frozen: HNF-6/ONECUT1 Antibody [NBP1-91607] - HNF6 Antibody [NBP1-91607] - Mouse embryo tissue, Primary Dilution 1:500 Secondary Dilution: 1:2000

• Reactivity: Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HNF-6/ONECUT1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards ONECUT1. Peptide sequence CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ONECUT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HNF-6/ONECUT1 Antibody - BSA Free

• HNF6
• HNF-6
• HNF-6A
• HNF6Ahepatocyte nuclear factor 6, alpha
• HNF6hepatocyte nuclear factor 6
• HNF-6One cut domain family member 1
• OC-1
• one cut homeobox 1one cut domain, family member 1
• ONECUT1

Background

Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HNF-6/ONECUT1 Antibody (NBP1-91607)(1)

Publication using NBP1-91607

• Xie G, Karaca G, Swiderska-Syn M et al. Cross-talk between notch and hedgehog regulates hepatic stellate cell fate. Hepatology 2013-05-23 [PMID: 23703657] (WB, Mouse)

Bioinformatics

• Gene Symbol: ONECUT1
• Uniprot:
  • NP_032288(Mouse)