HNF-4 gamma/NR2A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HNF-4 gamma/NR2A2 Antibody [NBP1-82531] - Staining of human small intestine shows high expression.

Immunohistochemistry-Paraffin: HNF-4 gamma/NR2A2 Antibody [NBP1-82531] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: HNF-4 gamma/NR2A2 Antibody [NBP1-82531] - Staining in human small intestine and liver tissues using anti-HNF4G antibody. Corresponding HNF4G RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HNF-4 gamma/NR2A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNF4G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HNF-4 gamma/NR2A2 Antibody - BSA Free

• hepatocyte nuclear factor 4, gamma
• hepatocyte nuclear factor 4-gamma
• HNF4 gamma
• HNF-4 gamma
• HNF4G
• HNF-4-gamma
• NR2A2
• NR2A2Nuclear receptor subfamily 2 group A member 2
• NR2A3

Background

Hepatocyte nuclear factor 4 gamma (HNF4 gamma) is a NR2 Hepatocyte NF4-Like receptor of relatively unknown function. Although HNF4 gamma is structurally related to HNF4 alpha and is expressed together with HNF 4 Alpha in pancreatic islets, it does not play a major role in the etiology of early onset, autosomal dominant, non insulin-dependent type 2 diabetes or maturity-onset diabetes of the young, MODY1. A pseudogene of HNF4 gamma, located on chromosome 13 (13q14.11 - 13q14.3), has been recently identified using a comparative genomics approach. HNF4 gamma expression has been reported human pancreas, kidney, testis, small intestine, and colon. ESTs have been isolated from human tissue libraries, including cancerous brain and colon, and normal brain,stomach, and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HNF-4 gamma/NR2A2 Antibody (NBP1-82531)(1)

Publication using NBP1-82531

• Suzuki T, Kilbey A, Casa-Rodr�guez N et al. ?-Catenin Drives Butyrophilin-like Molecule Loss and ?? T-cell Exclusion in Colon Cancer Cancer Immunology Research 2023-08-03 [PMID: 37309673] (Immunohistochemistry)

Bioinformatics

• Gene Symbol: HNF4G