HNF-3 beta/FoxA2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HNF-3 beta/FoxA2 Antibody - BSA Free (NBP2-57623) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS |
| Predicted Species |
Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FOXA2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HNF-3 beta/FoxA2 Antibody - BSA Free
Background
FOXA2 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ICC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, ChIP
Publications for HNF-3 beta/FoxA2 Antibody (NBP2-57623) (0)
There are no publications for HNF-3 beta/FoxA2 Antibody (NBP2-57623).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HNF-3 beta/FoxA2 Antibody (NBP2-57623) (0)
There are no reviews for HNF-3 beta/FoxA2 Antibody (NBP2-57623).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HNF-3 beta/FoxA2 Antibody (NBP2-57623) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HNF-3 beta/FoxA2 Products
Blogs on HNF-3 beta/FoxA2