HMGB3/HMG4 Antibody - BSA Free

Western Blot: HMGB3/HMG4 Antibody [NBP2-47434] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunocytochemistry/Immunofluorescence: HMGB3/HMG4 Antibody [NBP2-47434] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human pancreas shows no positivity as expected.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Analysis in human placenta and skeletal muscle tissues using NBP2-47434 antibody. Corresponding HMGB3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMGB3/HMG4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HMGB3/HMG4 Protein (NBP2-47434PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HMGB3/HMG4 Antibody - BSA Free

• High mobility group protein 2a
• High mobility group protein 4
• high mobility group protein B3
• high-mobility group (nonhistone chromosomal) protein 4
• high-mobility group box 3
• HMG2A
• HMG-2a
• HMG2AHMG-4
• HMG4
• HMG4MGC90319
• HMGB3
• non-histone chromosomal protein

Background

HMGB3 belongs to the high mobility group (HMG) protein superfamily. Like HMG1 (MIM 163905) and HMG2 (MIM 163906), HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription (Wilke et al., 1997 [PubMed 9370291]; Nemeth et al., 2006 [PubMed 16945912]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGB3