Recombinant Human HMGB1/HMG-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HMGB1/HMG-1 Protein Summary

Description
HMGB1/HMG-1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Protein/Peptide Type
Recombinant Protein
Gene
HMGB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00003146-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HMGB1/HMG-1 Protein

  • Amphoterin
  • high mobility group box 1
  • High mobility group protein 1
  • high mobility group protein B1
  • high-mobility group (nonhistone chromosomal) protein 1
  • high-mobility group box 1
  • HMG1
  • HMG-1
  • HMG1DKFZp686A04236
  • HMG3
  • HMGB1
  • SBP-1
  • Sulfoglucuronyl carbohydrate binding protein

Background

HMGB1( AAH03378, 1 a.a. - 216 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
7270-IL/CF
Species: Hu
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00026959-T01
Species: Hu
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
H00003146-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)(28)


Showing Publications 1 - 10 of 28. Show All 28 Publications.
Publications using H00003146-P01 Applications Species
Min G, Ku SK, Park MS et al. Anti-septic effects of pelargonidin on HMGB1-induced responses in vitro and in vivo. Arch Pharm Res 2016 Dec [PMID: 27778275]
Fang F, Jiang D. IL-1 B/HMGB1 Signaling Promotes the Inflammatory Cytokines Release via TLR S ignaling in Human Intervertebral Disc C ells. Biosci Rep 2016 Aug 10 [PMID: 27512095]
Yang EJ, Lee W, Song KS, Bae JS. Ameliorative effect of a rarely occurring C-methylrotenoid on HMGB1-induced septic responses in vitro and in vivo. Biochem Pharmacol 2016 Apr 19 [PMID: 27106082]
Tuan NQ, Lee W, Oh J et al. Flavanones and Chromones from Salicornia herbacea Mitigate Septic Lethality via Restoring Vascular Barrier Integrity. J Agric Food Chem. 2015 Oct 31 [PMID: 26522440]
Kwak S, Ku SK, Kang H et al. Methylthiouracil, a new treatment option for sepsis. Vascul Pharmacol. 2015 Aug 01 [PMID: 26239884]
Lee W, Park EJ, Kwak S et al. PEGylated lysozymes with anti-septic effects in human endothelial cells and in mice. Biochem Biophys Res Commun. 2015 Mar 11 [PMID: 25769950]
Kwak S, Ku SK, Han MS, Bae JS. Vascular barrier protective effects of baicalin, baicalein and wogonin in vitro and in vivo. Toxicol Appl Pharmacol. 2014 Sep 15 [PMID: 25223693]
Lee W, Ku SK, Bae JS. Factor Xa inhibits HMGB1-induced septic responses in human umbilical vein endothelial cells and in mice. Thromb Haemost. 2014 Jul 10 [PMID: 25007770]
Klawitter M, Hakozaki M, Kobayashi H et al. Expression and regulation of toll-like receptors (TLRs) in human intervertebral disc cells. Eur Spine J. 2014 Jul 05 [PMID: 24997157]
Lee W, Ku SK, Yoo H et al. Andrographolide inhibits HMGB1-induced inflammatory responses in HUVECs and in murine polymicrobial sepsis. Acta Physiol (Oxf). 2014 Mar 03 [PMID: 24581270]
Show All 28 Publications.

Reviews for HMGB1/HMG-1 Recombinant Protein (H00003146-P01) (0)

There are no reviews for HMGB1/HMG-1 Recombinant Protein (H00003146-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGB1/HMG-1 Recombinant Protein (H00003146-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HMGB1/HMG-1 Products

Bioinformatics Tool for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)

Discover related pathways, diseases and genes to HMGB1/HMG-1 Recombinant Protein (H00003146-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)

Discover more about diseases related to HMGB1/HMG-1 Recombinant Protein (H00003146-P01).
 

Pathways for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)

View related products by pathway.

PTMs for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)

Learn more about PTMs related to HMGB1/HMG-1 Recombinant Protein (H00003146-P01).
 

Research Areas for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)

Find related products by research area.

Blogs on HMGB1/HMG-1

There are no specific blogs for HMGB1/HMG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HMGB1/HMG-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB1
Entrez