Recombinant Human HMGB1/HMG-1 GST (N-Term) Protein

SDS-Page: Recombinant Human HMGB1/HMG-1 Protein [H00003146-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human HMGB1/HMG-1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-215 of Human HMGB1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: HMGB1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Competitive ELISA
  • ELISA
  • Immunoaffinity Purification
  • Immunocytochemistry/ Immunofluorescence
  • Protein Array
  • Sandwich ELISA
  • SDS-Page
  • Western Blot
• Theoretical MW: 49.39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HMGB1/HMG-1 GST (N-Term) Protein

• Amphoterin
• high mobility group box 1
• High mobility group protein 1
• high mobility group protein B1
• high-mobility group (nonhistone chromosomal) protein 1
• high-mobility group box 1
• HMG1
• HMG-1
• HMG1DKFZp686A04236
• HMG3
• HMGB1
• SBP-1
• Sulfoglucuronyl carbohydrate binding protein

Background

HMGB1( AAH03378, 1 a.a. - 216 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for HMGB1/HMG-1 Recombinant Protein (H00003146-P01)(36)

Publications using H00003146-P01

• Yang S, Lee W, Lee BS et al. Aloin Reduces HMGB1-Mediated Septic Responses and Improves Survival in Septic Mice by Activation of the SIRT1 and PI3K/Nrf2/HO-1 Signaling Axis. Am J Chin Med. 2019-04-09 [PMID: 30966773]
• Kim JE, Lee W, Yang S et al. Suppressive effects of rare ginsenosides, Rk1 and Rg5, on HMGB1-mediated septic responses. Food Chem Toxicol. 2018-11-26 [PMID: 30496780]
• Lee Y, Lee W, Chang HH et al. Testican-1, as a novel diagnosis of sepsis. J Cell Biochem 2018-01-08 [PMID: 29315764]
• Yang EJ, Lee W, Song KS, Bae JS. Ameliorative effect of a rarely occurring C-methylrotenoid on HMGB1-induced septic responses in vitro and in vivo. Biochem Pharmacol 2016-04-19 [PMID: 27106082]
• Yoo H, Ku S-K, Zhou W et al. Anti-septic effects of phenolic glycosides from Rhododendron brachycarpum in vitro and in vivo. Journal of Functional Foods 2015-04-29
• Lee W, Ku SK, Jeong TC et al. Ginsenosides Inhibit HMGB1-induced Inflammatory Responses in HUVECs and in Murine Polymicrobial Sepsis. Bull Korean Chem Soc 2014-06-10
• Lee IC, Kim DY, Bae JS. Sulforaphane Reduces HMGB1-Mediated Septic Responses and Improves Survival Rate in Septic Mice. Am J Chin Med 2017-08-22 [PMID: 28830206]
• Lee W, Ku SK, Bae JS. Zingerone reduces HMGB1-mediated septic responses and improves survival in septic mice. Toxicol Appl Pharmacol 2017-06-10 [PMID: 28610995]
• Min G, Ku SK, Park MS et al. Anti-septic effects of pelargonidin on HMGB1-induced responses in vitro and in vivo. Arch Pharm Res 2016-12-01 [PMID: 27778275]
• Lee W, Ku SK, Park S et al. Inhibitory Effect of Three Diketopiperazines from Marine-Derived Bacteria on HMGB1-Induced Septic Responses in Vitro and in Vivo. Am J Chin Med 2016-09-15 [PMID: 27627916]
• Fang F, Jiang D. IL-1 B/HMGB1 Signaling Promotes the Inflammatory Cytokines Release via TLR S ignaling in Human Intervertebral Disc C ells. Biosci Rep 2016-08-10 [PMID: 27512095]
• Tuan NQ, Lee W, Oh J et al. Flavanones and Chromones from Salicornia herbacea Mitigate Septic Lethality via Restoring Vascular Barrier Integrity. J Agric Food Chem. 2015-10-31 [PMID: 26522440]
• Kwak S, Ku SK, Kang H et al. Methylthiouracil, a new treatment option for sepsis. Vascul Pharmacol. 2015-08-01 [PMID: 26239884]
• Lee W, Park EJ, Kwak S et al. PEGylated lysozymes with anti-septic effects in human endothelial cells and in mice. Biochem Biophys Res Commun. 2015-03-11 [PMID: 25769950]
• Kwak S, Ku SK, Han MS, Bae JS. Vascular barrier protective effects of baicalin, baicalein and wogonin in vitro and in vivo. Toxicol Appl Pharmacol. 2014-09-15 [PMID: 25223693]
• Lee W, Ku SK, Bae JS. Factor Xa inhibits HMGB1-induced septic responses in human umbilical vein endothelial cells and in mice. Thromb Haemost. 2014-07-10 [PMID: 25007770]
• Klawitter M, Hakozaki M, Kobayashi H et al. Expression and regulation of toll-like receptors (TLRs) in human intervertebral disc cells. Eur Spine J. 2014-07-05 [PMID: 24997157]
• Lee W, Ku SK, Yoo H et al. Andrographolide inhibits HMGB1-induced inflammatory responses in HUVECs and in murine polymicrobial sepsis. Acta Physiol (Oxf). 2014-03-03 [PMID: 24581270]
• Ku SK, Kim JA, Bae JS. Vascular barrier protective effects of piperlonguminine in vitro and in vivo. Inflamm Res. 2014-01-29 [PMID: 24468889]
• Lee W, Ku SK, Lee YM, Bae JS. Anti-septic effects of glyceollins in HMGB1-induced inflammatory responses in vitro and in vivo. Food Chem Toxicol. 2013-10-30 [PMID: 24184598]
• Ku SK, Lee IC, Kim JA, Bae JS. Anti-septic Effects of Pellitorine in HMGB1-Induced Inflammatory Responses In Vitro and In Vivo. Inflammation. 2013-12-01 [PMID: 24077682]
• Lee W, Ku SK, Kim JA et al. Inhibitory effects of epi-sesamin on HMGB1-induced vascular barrier disruptive responses in vitro and in vivo. Toxicol Appl Pharmacol. 2013-01-23 [PMID: 23352503]
• Lee W, Ku SK, Kim TH, Bae JS. Emodin-6-O-b-D-glucoside inhibits HMGB1-induced inflammatory responses in vitro and in vivo. Food Chem Toxicol. 2012-11-09 [PMID: 23146691]
• Yang EJ, Ku SK, Lee W et al. Barrier protective effects of rosmarinic acid on HMGB1-induced inflammatory responses in vitro and in vivo. J Cell Physiol. 2012-10-05 [PMID: 23042518]
• Lee W, Ku SK, Bae JS. Barrier protective effects of rutin in LPS-induced inflammation in vitro and in vivo. Food Chem Toxicol. 2012-06-08 [PMID: 22721984]
• Lee W, Kim TH, Ku SK et al. Barrier protective effects of withaferin A in HMGB1-induced inflammatory responses in both cellular and animal models. Toxicol Appl Pharmacol. 2012-04-27 [PMID: 22561332]
• Kim TH, Ku SK, Lee T, Bae JS. Vascular barrier protective effects of phlorotannins on HMGB1-mediated proinflammatory responses in vitro and in vivo. Food Chem Toxicol. 2012-04-13 [PMID: 22504532]
• Lee W, Ku SK, Bae JW, Bae JS. Inhibitory effects of lycopene on HMGB1-mediated pro-inflammatory responses in both cellular and animal models. Food Chem Toxicol. 2012-03-10 [PMID: 22429818]
• Yang EJ, Lee W, Ku SK et al. Anti-inflammatory activities of oleanolic acid on HMGB1 activated HUVECs. Food Chem Toxicol. 2012-02-22 [PMID: 22386814]
• Kim TH, Ku SK, Bae JS. Inhibitory effects of kaempferol-3-O-sophoroside on HMGB1-mediated proinflammatory responses. Food Chem Toxicol. 2011-12-09 [PMID: 22178603]
• Bae JS. Effects of Lower Concentration Thrombin on High-Mobility Group Box 1 Protein-Mediated Inflammatory Responses. Inflammation. 2011-12-03 [PMID: 22139321]
• Kim DC, Lee W, Bae JS. Vascular anti-inflammatory effects of curcumin on HMGB1-mediated responses in vitro. Inflamm Res. 2011-09-16 [PMID: 21922289]
• Bae JS, Rezaie AR. Activated protein C inhibits high mobility group box 1 signaling in endothelial cells. Blood. 2011-08-17 [PMID: 21849480]
• Puch CB, Barbier E, Kraut A et al. TOX4 and its binding partners recognize DNA adducts generated by platinum anticancer drugs. Arch Biochem Biophys. 2010-12-22 [PMID: 21184731]
• Sasahira T, Kirita T, Bhawal UK et al. The expression of receptor for advanced glycation end products is associated with angiogenesis in human oral squamous cell carcinoma. Virchows Arch;450(3):287-95. 2007-03-01 [PMID: 17235565]
• Kuniyasu H, Yano S, Sasaki T et al. Colon cancer cell-derived high mobility group 1/amphoterin induces growth inhibition apoptosis in macrophages. Am J Pathol;166(3):751-60. 2005-03-01 [PMID: 15743787]

Bioinformatics

• Gene Symbol: HMGB1