HMGB1/HMG-1 Antibody (2F6)

Images

 
Western Blot: HMGB1/HMG-1 Antibody (2F6) [H00003146-M08] - Analysis of HMGB1 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: HMGB1/HMG-1 Antibody (2F6) [H00003146-M08] - Analysis of monoclonal antibody to HMGB1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: HMGB1/HMG-1 Antibody (2F6) [H00003146-M08] - Analysis of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: HMGB1/HMG-1 Antibody (2F6) [H00003146-M08] - Analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M08), clone 2F6. Lane 1: HMGB1 transfected lysatE (25 KDa). Lane 2: ...read more
ELISA: HMGB1/HMG-1 Antibody (2F6) [H00003146-M08] - Detection limit for recombinant GST tagged HMGB1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, B/N, ELISA, ICC/IF, IHC-P
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HMGB1/HMG-1 Antibody (2F6) Summary

Immunogen
HMGB1 (NP_002119, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK
Specificity
HMGB1 - high-mobility group box 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HMGB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Blocking/Neutralizing
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. IT has been used for IF, IHC-P, and ELISA. B/N usages reported in scientific literature (PMID: 21126167).
Publications
Read Publications using
H00003146-M08 in the following applications:

  • B/N
    3 publications
  • 1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMGB1/HMG-1 Antibody (2F6)

  • Amphoterin
  • high mobility group box 1
  • High mobility group protein 1
  • high mobility group protein B1
  • high-mobility group (nonhistone chromosomal) protein 1
  • high-mobility group box 1
  • HMG1
  • HMG-1
  • HMG1DKFZp686A04236
  • HMG3
  • HMGB1
  • SBP-1
  • Sulfoglucuronyl carbohydrate binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00026959-T01
Species: Hu
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for HMGB1/HMG-1 Antibody (H00003146-M08)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: B/N, ICC/IF, WB.


Filter By Application
B/N
(3)
ICC/IF
(1)
WB
(2)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00003146-M08 Applications Species
Yu Y, Xie Y, Cao L et al. The ferroptosis inducer erastin enhances sensitivity of acute myeloid leukemia cells to chemotherapeutic agents. Mol Cell Oncol 2015 Oct-Dec [PMID: 27308510] (WB) WB
Yang M, Liu L, Xie M et al. Poly-ADP-ribosylation of HMGB1 regulates TNFSF10/TRAIL resistance through autophagy Autophagy. 2015 Jan 21 [PMID: 25607248]
Amornsupak K, Insawang T, Thuwajit P et al. Cancer-associated fibroblasts induce high mobility group box 1 and contribute to resistance to doxorubicin in breast cancer cells. BMC Cancer. 2015 Jan 08 [PMID: 25512109] (B/N, Human) B/N Human
Livesey KM, Kang R, Vernon P et al. p53/HMGB1 Complexes Regulate Autophagy and Apoptosis. Cancer Res;72(8):1996-2005. 2012 Apr 15. [PMID: 22345153] (WB, ICC/IF, Human) WB, ICC/IF Human
Tang D, Kang R, Livesey KM et al. High mobility group box 1 (HMGB1) activates an autophagic response to oxidative stress. Antioxid Redox Signal. 2011 Oct 15 [PMID: 21395369] (B/N) B/N
Kang R, Tang D, Livesey KM et al. The Receptor for Advanced Glycation End-products (RAGE) protects pancreatic tumor cells against oxidative injury. Antioxid Redox Signal. 2011 Oct 15 [PMID: 21126167] (B/N, Human) B/N Human
Gong W, Zheng Y, Chao F et al. The anti-inflammatory activity of HMGB1 A box is enhanced when fused with C-terminal acidic tail. J Biomed Biotechnol:915234. 2010 [PMID: 20379370]
Zhou J, Huang JD, Poon VK et al. Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection. J Hepatol. 2009 May 03 [PMID: 19501422]

Reviews for HMGB1/HMG-1 Antibody (H00003146-M08) (0)

There are no reviews for HMGB1/HMG-1 Antibody (H00003146-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HMGB1/HMG-1 Antibody (H00003146-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGB1/HMG-1 Products

Bioinformatics Tool for HMGB1/HMG-1 Antibody (H00003146-M08)

Discover related pathways, diseases and genes to HMGB1/HMG-1 Antibody (H00003146-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB1/HMG-1 Antibody (H00003146-M08)

Discover more about diseases related to HMGB1/HMG-1 Antibody (H00003146-M08).
 

Pathways for HMGB1/HMG-1 Antibody (H00003146-M08)

View related products by pathway.

PTMs for HMGB1/HMG-1 Antibody (H00003146-M08)

Learn more about PTMs related to HMGB1/HMG-1 Antibody (H00003146-M08).
 

Research Areas for HMGB1/HMG-1 Antibody (H00003146-M08)

Find related products by research area.

Blogs on HMGB1/HMG-1

There are no specific blogs for HMGB1/HMG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGB1/HMG-1 Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB1
Entrez
OMIM
Uniprot