AKIP Antibody

Images

 
Western Blot: AKIP Antibody [NBP1-90202] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: AKIP Antibody [NBP1-90202] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, mitochondria & vesicles.
Immunohistochemistry-Paraffin: AKIP Antibody [NBP1-90202] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AURKAIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AKIP Protein (NBP1-90202PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKIP Antibody

  • AIPAKIPaurora kinase A-interacting protein
  • AURKA-interacting protein
  • aurora kinase A interacting protein 1
  • aurora-A kinase interacting protein
  • FLJ20608

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31881
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AKIP Antibody (NBP1-90202) (0)

There are no publications for AKIP Antibody (NBP1-90202).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKIP Antibody (NBP1-90202) (0)

There are no reviews for AKIP Antibody (NBP1-90202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKIP Antibody (NBP1-90202) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKIP Products

Bioinformatics Tool for AKIP Antibody (NBP1-90202)

Discover related pathways, diseases and genes to AKIP Antibody (NBP1-90202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKIP Antibody (NBP1-90202)

Discover more about diseases related to AKIP Antibody (NBP1-90202).

PTMs for AKIP Antibody (NBP1-90202)

Learn more about PTMs related to AKIP Antibody (NBP1-90202).
 

Research Areas for AKIP Antibody (NBP1-90202)

Find related products by research area.

Blogs on AKIP

There are no specific blogs for AKIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKAIP1
Entrez
Uniprot