Home » HMBOX1 » HMBOX1 Proteins » HMBOX1 Recombinant Protein Antigen

HMBOX1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HMBOX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HMBOX1.

Source: E.coli

Amino Acid Sequence: IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HMBOX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58377 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HMBOX1 Recombinant Protein Antigen

  • FLJ21616
  • HNF1LA
  • homeobox containing 1
  • homeobox-containing protein 1
  • homeobox-containing protein PBHNF
  • PBHNF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(428 Publications)
Species: Hu
Applications: BA
DAP10/HCST
Antibody (982101) [Un ...
MAB97861
Immunohistochemistry-Paraffin: DAP10/HCST Antibody (982101) [Unconjugated] [MAB97861] - DAP10/HCST was detected in immersion fixed paraffin-embedded sections of human kidney using Mouse Anti-Human DAP10/HCST Monoclonal Antibody (Catalog # MAB97861) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei.
Species: Hu
Applications: Flow, IHC, IHC-P
DNAM-1/CD226
Antibody (102511) [Un ...
MAB666
Recombinant Human DNAM-1/CD226 Fc Chimera (Catalog # 666-DN), immobilized onto a microplate, supports the adhesion of the COLO 205 human colorectal adenocarcinoma cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Human DNAM-1/CD226 Fc Chimera (20 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human DNAM-1/CD226 Monoclonal Antibody (Catalog # MAB666). The ND50 is typically 0.1-0.6 µg/mL.
Human peripheral blood mononuclear cells (PBMCs) gated on CD3- cells were stained with Mouse Anti-Human NCAM‑1/CD56 APC‑conjugated Monoclonal Antibody (Catalog # FAB2408A) and either (A) Mouse Anti-Human DNAM-1/CD226 Monoclonal Antibody (Catalog # MAB666) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(1 Review)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
LAMP-1/CD107a
Antibody (5E7) - BSA
NBP2-52721
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - MCF-7 human breast cancer cell line. Secondary antibody goat anti-mouse IgG Fc Dy680 (NBP1-72880). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - ICC usage of NBP2-52721. Image submittied via verified customer review.
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-LAMP (5E7) at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NKG2D/CD314
Antibody (149810) [Un ...
MAB139
Human peripheral blood mononuclear cells (PBMCs) gated on CD3- cells were stained with Mouse Anti-Human NCAM‑1/CD56 APC‑conjugated Monoclonal Antibody (Catalog # FAB2408A) and either (A) Mouse Anti-Human NKG2D/CD314 Monoclonal Antibody (Catalog # MAB139) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by anti-Mouse IgG PE-conjugated Monoclonal Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(3 Reviews)
(76 Publications)
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
CD94 Antibody
(131412) [Unconjugate
MAB1058
CD94 Antibody (131412) [Unconjugated]
(3 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(14 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Hela cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Jurkat cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RanGAP1 antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, human thymus tissue, mouse thymus tissue, and rat CD4+ T cells. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat Ets-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7284) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Ets-1 at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Ets‑1 was detected in immersion fixed paraffin-embedded sections of human ovary using Sheep Anti-Human/Mouse/Rat Ets‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7284) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC006). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu, Mu, Rt
Applications: IHC, WB
CXCL10/IP-10/CRG-2
[HRP]
DIP100
(10 Reviews)
(118 Publications)
Species: Hu
Applications: ELISA
HMGB1/HMG-1
Antibody
NB100-2322
Flow (Intracellular): HMGB1/HMG-1 Antibody [NB100-2322] - An intracellular stain was performed on HeLa with NB100-2322 and a matched isotype control. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Immunohistochemistry-Paraffin: HMGB1/HMG-1 Antibody [NB100-2322] - Rabbit blood vessel. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: HMGB1/HMG-1 Antibody [NB100-2322] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-HMGB1 [NB100-2322] at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) [NB100-690] was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(5 Reviews)
(25 Publications)
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human colon adenocarcinoma (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of colorectal adenocarcinoma with anti-FUT3/Blood Group Lewis A (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human pancreas (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(704 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(333 Publications)
Species: Hu
Applications: BA
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
KIR2DL4/CD158d
Antibody (181703) [Un ...
MAB2238
Human KIR2DL4/CD158d Monoclonal Antibody induces IFN‑ gamma secretion in the NK-92 human natural killer lymphoma cell line in a dose-dependent manner, as measured using the Quantikine Human IFN‑ gamma  ELISA Kit (Catalog # DIF50). The ED50 for this effect is typically 0.5‑2 μg/mL.
(7 Publications)
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
IL-15
[Unconjugated]
247-ILB/CF
1 µg/lane of Recombinant Human IL-15 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 10 kDa.
Recombinant Human IL-15 (Catalog #247-ILB/CF) stimulates cell proliferation in the MO7e human megakaryocytic leukemic cell line. The ED50 for this effect is 0.3-2.6 ng/mL.
(146 Publications)
Species: Hu
Applications: BA
Aquaporin-2
Antibody - BSA Free
NB110-74682
Immunocytochemistry/Immunofluorescence: Aquaporin-2 Antibody [NB110-74682] - Staining of mpkCCD cell line
Western Blot: Aquaporin-2 Antibody [NB110-74682] - Detection of Aquaporin 2 in rat kidney extracts. Cortex (CX), Outer Medulla (OM), Inner Medulla Base (IMB), Inner Medulla Papilla (IMP).
Immunocytochemistry/Immunofluorescence: Aquaporin-2 Antibody [NB110-74682] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-Aquaporin-2 Antibody NB110-74682 at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(28 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
HMBOX1 Recombinant
Protein Antigen
NBP2-58377PEP
HMBOX1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP) (0)

There are no publications for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP) (0)

There are no reviews for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HMBOX1 Products

Bioinformatics Tool for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP)

Discover related pathways, diseases and genes to HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP)

Discover more about diseases related to HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP).
 

Pathways for HMBOX1 Recombinant Protein Antigen (NBP2-58377PEP)

View related products by pathway.

Blogs on HMBOX1

There are no specific blogs for HMBOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HMBOX1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HMBOX1