Home » HLX1 » HLX1 Antibodies » HLX1 Antibody (1B9)

HLX1 Antibody (1B9)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HLX1 Antibody (1B9) [H00003142-M05] - Analysis of HLX transfected lysate using anti-HLX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLX rabbit polyclonal antibody.
Western Blot: HLX1 Antibody (1B9) [H00003142-M05] - Analysis of HLX transfected lysate using anti-HLX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLX rabbit polyclonal antibody.
Western Blot: HLX1 Antibody (1B9) [H00003142-M05] - Analysis of HLX expression in transfected 293T cell line by HLX1 monoclonal antibody (M05), clone 1B9. Lane 1: HLX transfected lysate (Predicted MW: 50.8 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HLX1 Antibody (1B9) Summary

Immunogen
HLX1 (NP_068777 176 a.a. - 279 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
Specificity
HLX1 - H2.0-like homeobox 1 (Drosophila) (1B9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLX1 Antibody (1B9)

  • H2.0 (Drosophila)-like homeo box 1
  • H2.0-like homeo box 1
  • H2.0-like homeo box-1
  • H2.0-like homeobox 1
  • H2.0-like homeobox protein
  • H2.0-like homeobox
  • HB24
  • HLX1H2.0-like homeobox 1 (Drosophila)
  • Homeobox protein HB24
  • Homeobox protein HLX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

T-bet/TBX21
Antibody (39D)
NBP1-43299
Western Blot: T-bet/TBX21 Antibody (39D) [NBP1-43299] - CD4+ T cells were sorted from mouse splenocytes, then activated with Anti-Mouse CD3 and Anti-Mouse CD28, followed by culture in Th1-polarizing conditions, and re-stimulation with PMA and Ionomycin. Lysates from control (left) or PMA and Ionomycin-re-stimulated (right) cells were probed with Anti-T-bet Purified at 2 ug/ml, and revealed with Anti-Mouse IgG HRP.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
BP1 Antibody
NB100-481
Western Blot: BP1 Antibody [NB100-481] - Detection of MDA-MB-231 cell lysates.
Immunohistochemistry-Frozen: BP1 Antibody [NB100-481] - Top Panel: BP1 antibody detected in breast cancer cells. Bottom Panel: Staining of normal breast tissue.
Immunoprecipitation: BP1 Antibody [NB100-481] - Antibody diluted 1:5,000 2. BP1-specific band after immunoprecipitation of 850 ug of cell extract using anti-BP1 (NB100-481) antibody diluted 1:1,000 3. Negative control for IP in lane 2: cell extract incubated with 50ul of Protein A/G beads.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
GATA-3 Antibody
[Unconjugated]
AF2605
Western blot shows lysates of MCF‑7 human breast cancer cell line, Jurkat human acute T cell leukemia cell line, and EL‑4 mouse lymphoblast cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). Specific bands were detected for GATA‑3 full length (FL) at approximately 55 kDa and the splice form (SF) at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GATA‑3 was detected in immersion fixed MCF-7 human breast cancer cell line using 10 µg/mL Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
GATA‑3 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(7 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(256 Publications)
Species: Hu
MNX1/HLXB9 Antibody
NBP2-24691
Western Blot: MNX1/HLXB9 Antibody [NBP2-24691] - Analysis of HB9 in MOLT-4 cell lysates in the 1) absence and 2) presence of immunizing peptide using this antibody at 5 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: MNX1/HLXB9 Antibody [NBP2-24691] - Analysis of HB9 in formalin-fixed, paraffin-embedded mouse pancreas tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Species: Hu, Mu
Applications: WB, IHC-P
MSX2 Antibody
NBP1-85445
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in human cell line BEWO.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MEOX 2 Antibody
(6A5)
H00004223-M03
Western Blot: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of MEOX2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of monoclonal antibody to MEOX2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: MEOX 2 Antibody (6A5) [H00004223-M03] - Analysis of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1 ug/ml
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
(7 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
TGF-beta 2
302-B2/CF
1 μg/lane of Recombinant Human TGF-beta 2 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 12 kDa and 24 kDa, respectively.
Recombinant Human TGF-beta 2 (Catalog # 302-B2/CF) inhibits Recombinant Mouse IL‑4 (Catalog # 404-ML) induced cell proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.025-0.25 ng/mL.
(49 Publications)
Species: Hu
GATA-3 Antibody
[Unconjugated]
AF2605
Western blot shows lysates of MCF‑7 human breast cancer cell line, Jurkat human acute T cell leukemia cell line, and EL‑4 mouse lymphoblast cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). Specific bands were detected for GATA‑3 full length (FL) at approximately 55 kDa and the splice form (SF) at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
GATA‑3 was detected in immersion fixed MCF-7 human breast cancer cell line using 10 µg/mL Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
GATA‑3 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Goat Anti-Human GATA‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2605) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(7 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
IL-4 [Unconjugated]
204-IL
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-4 (Catalog # 204-IL) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.05-02 ng/mL.
(8 Reviews)
(285 Publications)
Species: Hu
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Sonic Hedgehog/Shh
[Unconjugated]
461-SH/CF
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus (Catalog # 461-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.6‑3 μg/mL.
(26 Publications)
Species: Mu
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(11 Reviews)
(236 Publications)
Species: Hu
Tetraspanin-31
Antibody
NBP2-33838
Immunohistochemistry-Paraffin: Tetraspanin-31 Antibody [NBP2-33838] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Species: Hu
Applications: IHC, IHC-P
NANS Antibody
NBP1-87088
Western Blot: NANS Antibody [NBP1-87088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: NANS Antibody [NBP1-87088] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NANS Antibody [NBP1-87088] - Staining of human pancreas shows strong nuclear and weaker cytoplasmic positivity.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HLX1 Antibody (H00003142-M05) (0)

There are no publications for HLX1 Antibody (H00003142-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLX1 Antibody (H00003142-M05) (0)

There are no reviews for HLX1 Antibody (H00003142-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLX1 Antibody (H00003142-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HLX1 Antibody (H00003142-M05)

Discover related pathways, diseases and genes to HLX1 Antibody (H00003142-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLX1 Antibody (H00003142-M05)

Discover more about diseases related to HLX1 Antibody (H00003142-M05).
 

Pathways for HLX1 Antibody (H00003142-M05)

View related products by pathway.

PTMs for HLX1 Antibody (H00003142-M05)

Learn more about PTMs related to HLX1 Antibody (H00003142-M05).

Blogs on HLX1

There are no specific blogs for HLX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLX1 Antibody (1B9) and receive a gift card or discount.


Bioinformatics

Gene Symbol HLX
Entrez
Uniprot