HLX1 Antibody (1B9)

Images

 
Western Blot: HLX1 Antibody (1B9) [H00003142-M05] - Analysis of HLX transfected lysate using anti-HLX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLX rabbit polyclonal antibody.
Western Blot: HLX1 Antibody (1B9) [H00003142-M05] - Analysis of HLX expression in transfected 293T cell line by HLX1 monoclonal antibody (M05), clone 1B9. Lane 1: HLX transfected lysate (Predicted MW: 50.8 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLX1 Antibody (1B9) Summary

Immunogen
HLX1 (NP_068777 176 a.a. - 279 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
Specificity
HLX1 - H2.0-like homeobox 1 (Drosophila) (1B9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLX1 Antibody (1B9)

  • H2.0 (Drosophila)-like homeo box 1
  • H2.0-like homeo box 1
  • H2.0-like homeo box-1
  • H2.0-like homeobox 1
  • H2.0-like homeobox protein
  • H2.0-like homeobox
  • HB24
  • HLX1H2.0-like homeobox 1 (Drosophila)
  • Homeobox protein HB24
  • Homeobox protein HLX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-481
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
302-B2/CF
Species: Hu
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
6507-IL/CF
Species: Hu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HLX1 Antibody (H00003142-M05) (0)

There are no publications for HLX1 Antibody (H00003142-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLX1 Antibody (H00003142-M05) (0)

There are no reviews for HLX1 Antibody (H00003142-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLX1 Antibody (H00003142-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HLX1 Antibody (H00003142-M05)

Discover related pathways, diseases and genes to HLX1 Antibody (H00003142-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLX1 Antibody (H00003142-M05)

Discover more about diseases related to HLX1 Antibody (H00003142-M05).
 

Pathways for HLX1 Antibody (H00003142-M05)

View related products by pathway.

PTMs for HLX1 Antibody (H00003142-M05)

Learn more about PTMs related to HLX1 Antibody (H00003142-M05).

Blogs on HLX1

There are no specific blogs for HLX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLX1 Antibody (1B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol HLX
Entrez
Uniprot