HLF Antibody (M1)

Images

 
Western Blot: HLF Antibody (M1) [H00003131-M03] - analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M03), clone M1. Lane 1: HLF transfected lysate (33.2 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
M1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLF Antibody (M1) Summary

Immunogen
HLF (AAH36093, 1 a.a. - 295 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Specificity
HLF - hepatic leukemia factor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLF Antibody (M1)

  • hepatic leukemia factor
  • MGC33822

Background

This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007008-T01
Species: Hu
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB8570
Species: Hu
Applications: Flow, CyTOF-ready
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC

Publications for HLF Antibody (H00003131-M03) (0)

There are no publications for HLF Antibody (H00003131-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLF Antibody (H00003131-M03) (0)

There are no reviews for HLF Antibody (H00003131-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLF Antibody (H00003131-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLF Products

Bioinformatics Tool for HLF Antibody (H00003131-M03)

Discover related pathways, diseases and genes to HLF Antibody (H00003131-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLF Antibody (H00003131-M03)

Discover more about diseases related to HLF Antibody (H00003131-M03).
 

Pathways for HLF Antibody (H00003131-M03)

View related products by pathway.

PTMs for HLF Antibody (H00003131-M03)

Learn more about PTMs related to HLF Antibody (H00003131-M03).

Blogs on HLF

There are no specific blogs for HLF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLF Antibody (M1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HLF
Entrez
OMIM
Uniprot