Home » HLF » HLF Antibodies » HLF Antibody (1F12-1C4)

HLF Antibody (1F12-1C4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HLF Antibody (1F12-1C4) [H00003131-M01] - Analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M01), clone 1F12-1C4.Lane 1: HLF transfected lysate(33.2 KDa).Lane 2: Non-transfected lysate.
Western Blot: HLF Antibody (1F12-1C4) [H00003131-M01] - Analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M01), clone 1F12-1C4.Lane 1: HLF transfected lysate(33.2 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: HLF Antibody (1F12-1C4) [H00003131-M01] - Analysis of monoclonal antibody to HLF on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F12-1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HLF Antibody (1F12-1C4) Summary

Immunogen
HLF (AAH36093, 1 a.a. - 295 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Specificity
HLF - hepatic leukemia factor
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLF Antibody (1F12-1C4)

  • hepatic leukemia factor
  • MGC33822

Background

This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tef Overexpression
Lysate
NBL1-16806
Western Blot: Tef Overexpression Lysate (Adult Normal) [NBL1-16806] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Tef.
Species: Hu
TCF-3/E2A Antibody
NBP2-38611
Immunocytochemistry/Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human lymph node shows no positivity in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Vitamin D BP
Antibody
NBP1-88027
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
HSD17B4 Antibody
NBP1-85296
Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lung.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
D Box Binding
Protein Knockout 293T ...
NBP2-65684
D Box Binding Protein Knockout 293T Cell Lysate
Species: Hu
PXR/NR1I2 Antibody
(1D12G1)
NBP2-61816
Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against human NR1I2 (AA: 1-142) recombinant protein. (Expected MW is 42.2 kDa)
Immunocytochemistry/Immunofluorescence: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis of Hela cells using NR1I2 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 Secondary antibody was used.
Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against HEK293 (1) and NR1I2 (AA: 1-142)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
JTB Antibody
NBP1-81746
Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Endorepellin/Perlecan/ ...
AF2364
Endorepellin/Perlecan was detected in immersion fixed paraffin-embedded sections of human skin using 5 µg/mL Goat Anti-Human Endorepellin/Perlecan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2364) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - HIF-1 alpha induction by CoCl2 on Caki-1 cell lysate. Image from verified customer review.
Knockout Validated: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - HIF-1 alpha was detected in immersion fixed DFO treated Hela cells (left) but was not detected in HIF-1 knockout HeLa cells (right) using Mouse Anti-human HIF-1 alpha monoclonal antibody (Catalog #NB100-105) at 25 ug/mL for 3 hours at room temperature. Cells were stained using a NorthernLights (TM) 557-conjugated Donkey Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei.
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Analysis using the HRP conjugate of NB100-105. Detection of 50ug cobalt chloride induced COS-7 nuclear extracts (NB800-PC26) using NB100-105.
(39 Reviews)
(782 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(41 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NFIL3 Antibody
(714401) [Unconjugate
MAB8570
Human peripheral blood mononuclear cells (PBMCs) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human CD3 epsilon PE‑conjugated Monoclonal Antibody (Catalog # FAB100P) and either (A) Mouse Anti-Human NFIL3/E4BP4 Monoclonal Antibody (Catalog # MAB8570) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B) To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012).
Species: Hu
Applications: Flow, CyTOF-ready
HIF-2 alpha/EPAS1
Antibody
NB100-122
Western Blot: HIF-2 alpha/EPAS1 Antibody [NB100-122] - HIF-2 alpha in human retinal and choroidal primary endothelia lysates using HIF-2 alpha/EPAS1 Antibody.. Image from verified customer review.
Immunohistochemistry: HIF-2 alpha/EPAS1 Antibody [NB100-122] - Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
Western Blot: HIF-2 alpha/EPAS1 Antibody [NB100-122] - HIF-2 alpha in MDA-MB-231 cell lysate (overexpression and endogenous samples) using HIF-2 alpha/EPAS1 Antibody.HIF-2 alpha/EPAS1 Antibody did not react to HIF-1 alpha overexpression. Image from verified customer review.
(31 Reviews)
(600 Publications)
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE, KO
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Exosome component
1 Antibody (OTI1H9)
NBP2-45545
Western Blot: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Exosome component 1.
Immunohistochemistry: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: Exosome component 1 Antibody (1H9) [NBP2-45545] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
FAM126A Antibody
NBP1-32914
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE; antibody diluted at 1:10000.
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (50 ug of whole cell lysate) A: mouse brain 7. 5% SDS PAGE, antibody diluted at 1:3000.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(24 Reviews)
(602 Publications)
Species: Hu
TCF7L1/TCF3
Antibody
AF6116
Western blot shows lysates of human pancreas and human lung tissue. PVDF Membrane was probed with 0.2 µg/mL of Human TCF7L1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6116) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for TCF7L1 at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TCF7L1 was detected in immersion fixed BG01V human embryonic stem cells using Human TCF7L1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6116) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, upper panel; Catalog # NL012) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC

Publications for HLF Antibody (H00003131-M01) (0)

There are no publications for HLF Antibody (H00003131-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLF Antibody (H00003131-M01) (0)

There are no reviews for HLF Antibody (H00003131-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HLF Antibody (H00003131-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HLF Products

Array H00003131-M01

Bioinformatics Tool for HLF Antibody (H00003131-M01)

Discover related pathways, diseases and genes to HLF Antibody (H00003131-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLF Antibody (H00003131-M01)

Discover more about diseases related to HLF Antibody (H00003131-M01).
 

Pathways for HLF Antibody (H00003131-M01)

View related products by pathway.

PTMs for HLF Antibody (H00003131-M01)

Learn more about PTMs related to HLF Antibody (H00003131-M01).

Blogs on HLF

There are no specific blogs for HLF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLF Antibody (1F12-1C4) and receive a gift card or discount.


Bioinformatics

Gene Symbol HLF
Entrez
OMIM
Uniprot