HLA DRB1 Antibody - BSA Free

Western Blot: HLA DRB1 Antibody [NBP3-03666] - Analysis of extracts of various cell lines, using HLA DRB1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLA DRB1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human HLA DRB1 (NP_002115.2). GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DRB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HLA DRB1 Antibody - BSA Free

• Clone P2-beta-3
• DR1
• DR-1
• DR12
• DR-12
• DR13
• DR-13
• DR14
• DR-14
• DR16
• DR-16
• DR4
• DR-4
• DR5
• DR-5
• DR7
• DR-7
• DR8
• DR-8
• DR9
• DR-9
• DRB1
• DRw10
• DRw11
• DRw8
• DW2.2/DR2.2
• FLJ75017
• FLJ76359
• HLA class II antigen beta chain
• HLA class II histocompatibility antigen, DR-1 beta chain
• HLA-DR1B
• HLA-DRB
• HLA-DRB1
• HLA-DRB1*
• HLA-DRB2
• HLA-DR-beta 1
• human leucocyte antigen DRB1
• leucocyte antigen DR beta 1 chain
• leucocyte antigen DRB1
• lymphocyte antigen DRB1
• major histocompatibility complex, class II, DR beta 1
• MHC class II antigen DRB1*1
• MHC class II antigen DRB1*10
• MHC class II antigen DRB1*11
• MHC class II antigen DRB1*12
• MHC class II antigen DRB1*13
• MHC class II antigen DRB1*14
• MHC class II antigen DRB1*15
• MHC class II antigen DRB1*16
• MHC class II antigen DRB1*3
• MHC class II antigen DRB1*4
• MHC class II antigen DRB1*7
• MHC class II antigen DRB1*8
• MHC class II antigen DRB1*9
• MHC class II antigen HLA-DR13
• MHC class II HLA-DR beta 1 chain
• MHC class II HLA-DR-beta cell surface glycoprotein
• MHC class II HLA-DRw10-beta
• SS1

Background

HLA DRB1 can be used for HLA typing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for HLA DRB1 Antibody (NBP3-03666). (Showing 1 - 1 of 1 FAQ).

1. We are interested in custom labeling our antibodies to be able to integrate new markers into already existing multicolor FACS panels. We would be glad to receive pricing and general order information for anti-HLA-DRB1 and anti-HLA-DRB5. To estimate expenses for future antibody labeling orders it would be helpful to know on what basis (amount, type, etc.) the price is going to be calculated. Right now the antibodies are still in mouse ascites. Would it be possible to integrate the elution of the antibodies from the ascites before labeling as part of the service agreement?
   • While we do not generally do this kind of custom purification unless it is for very large amounts of antibody, we do have a number of kits available that may be of use to you. Since an antibody that is still in ascites can not be labeled, it will need to be purified. A list of our kits available for this can be found at the following link: AbSelect. Once the antibodies are purified, they can be labeled with any number of different colors. A list of these kits for labeling can be found at the following link: Lightning-Link.

Bioinformatics

• Gene Symbol: HLA-DRB1