Novus Biologicals products are now on bio-techne.com

HLA DPB1 Antibody

Images

 
Western Blot: HLA DPB1 Antibody [NBP1-89688] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining in human lymph node and cerebral cortex tissues.. Corresponding HLA-DPB1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human tonsil shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: HLA DPB1 Antibody [NBP1-89688] - Staining of human lymph node shows strong membranous positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HLA DPB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DPB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HLA DPB1 Protein (NBP1-89688PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DPB1 Antibody

  • DP beta 1 chain
  • DPB1
  • HLA class II histocompatibility antigen, DP(W4) beta chain
  • HLA DP14-beta chain
  • HLA-DP histocompatibility type, beta-1 subunit
  • HLA-DP1B
  • HLA-DPB
  • major histocompatibility complex class II HLA DPB1 protein
  • major histocompatibility complex, class II, DP beta 1
  • MHC class II antigen beta chain
  • MHC class II antigen DP beta 1 chain
  • MHC class II antigen DPB1
  • MHC class II antigen DPbeta1
  • MHC class II HLA-DP-beta
  • MHC HLA DPB1

Background

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
MAB9080
Species: Hu
Applications: WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP2-14093
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-16006
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-16851
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NBP3-17054
Species: Hu
Applications: IHC, IHC-P
6507-IL/CF
Species: Hu
Applications: BA
NBP1-89688
Species: Hu
Applications: WB, IHC

Publications for HLA DPB1 Antibody (NBP1-89688) (0)

There are no publications for HLA DPB1 Antibody (NBP1-89688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DPB1 Antibody (NBP1-89688) (0)

There are no reviews for HLA DPB1 Antibody (NBP1-89688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DPB1 Antibody (NBP1-89688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DPB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DPB1