HLA DMB Recombinant Protein Antigen

Images

 
There are currently no images for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HLA DMB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLA DMB

Source: E. coli

Amino Acid Sequence: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HLA-DMB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17866.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HLA DMB Recombinant Protein Antigen

  • class II histocompatibility antigen, M beta chain
  • D6S221E
  • DMB
  • major histocompatibility complex, class II, DM beta
  • MHC class II antigen DMB
  • MHC class II antigen HLA-DM beta chain
  • MHC class II HLA-DMB
  • Really interesting new gene 7 protein
  • RING7HLA class II histocompatibility antigen, DM beta chain

Background

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21789
Species: Mu, Rt
Applications: CyTOF-ready, Flow, Func, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84450
Species: Hu, Mu
Applications: IHC-WhMt, IHC,  IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48836
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-59072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-85569
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85568
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17866PEP
Species: Hu
Applications: AC

Publications for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP) (0)

There are no publications for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP) (0)

There are no reviews for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DMB Products

Research Areas for HLA DMB Recombinant Protein Antigen (NBP3-17866PEP)

Find related products by research area.

Blogs on HLA DMB.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HLA DMB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DMB