HLA A Antibody [Alexa Fluor® 700]

Images

 
There are currently no images for HLA A Antibody (NBP3-37966AF700).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Alexa Fluor 700

Order Details

HLA A Antibody [Alexa Fluor® 700] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 35-285 of human HLA A (NP_002107.3).

Sequence:
GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for HLA A Antibody [Alexa Fluor® 700]

  • A-10 alpha chain
  • FLJ26655
  • HLA class I histocompatibility antigen, A-1 alpha chain
  • HLA class I histocompatibility antigen, A-28 alpha chain
  • HLA class I histocompatibility antigen, A-9 alpha chain
  • HLAA
  • major histocompatibility complex, class I, A
  • MHC class I antigen A*1
  • MHC class I antigen A*11
  • MHC class I antigen A*80

Background

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-46107
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NB500-302
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NBP1-89985
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for HLA A Antibody (NBP3-37966AF700) (0)

There are no publications for HLA A Antibody (NBP3-37966AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA A Antibody (NBP3-37966AF700) (0)

There are no reviews for HLA A Antibody (NBP3-37966AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA A Antibody (NBP3-37966AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA A Products

Research Areas for HLA A Antibody (NBP3-37966AF700)

Find related products by research area.

Blogs on HLA A

There are no specific blogs for HLA A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA A Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-A