HIV-1 Rev binding protein (HRB) Antibody

Images

 
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIV-1 Rev binding protein (HRB) Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAG
Specificity
Specificity of human, mouse, rat HIV-1 Rev binding protein (HRB) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGFG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HIV-1 Rev binding protein (HRB) Protein (NBP1-91991PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIV-1 Rev binding protein (HRB) Antibody

  • ArfGAP with FG repeats 1
  • DKFZp686I15205
  • HIV-1 Rev-binding protein
  • HRBRev interacting protein
  • Rab, Rev/Rex activation domain-binding protein
  • RABMGC116938
  • RIPMGC116940

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87826
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2658
Species: Hu
Applications: WB, IHC
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991) (0)

There are no publications for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991) (0)

There are no reviews for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991)

Discover related pathways, diseases and genes to HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991)

Discover more about diseases related to HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991).
 

Pathways for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991)

View related products by pathway.

PTMs for HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991)

Learn more about PTMs related to HIV-1 Rev binding protein (HRB) Antibody (NBP1-91991).

Blogs on HIV-1 Rev binding protein (HRB)

There are no specific blogs for HIV-1 Rev binding protein (HRB), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIV-1 Rev binding protein (HRB) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGFG1