HIPK2 Antibody

Images

 
Immunohistochemistry-Paraffin: HIPK2 Antibody [NBP1-89462] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIPK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTSLPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIPK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HIPK2 Protein (NBP1-89462PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIPK2 Antibody

  • DKFZp686K02111
  • EC 2.7.11.1
  • FLJ23711
  • hHIPk2
  • HIPK2
  • homeodomain interacting protein kinase 2
  • homeodomain-interacting protein kinase 2
  • PRO0593
  • Stank

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00051701-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, PLA
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF5617
Species: Hu
Applications: WB
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for HIPK2 Antibody (NBP1-89462) (0)

There are no publications for HIPK2 Antibody (NBP1-89462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIPK2 Antibody (NBP1-89462) (0)

There are no reviews for HIPK2 Antibody (NBP1-89462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HIPK2 Antibody (NBP1-89462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIPK2 Products

Bioinformatics Tool for HIPK2 Antibody (NBP1-89462)

Discover related pathways, diseases and genes to HIPK2 Antibody (NBP1-89462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIPK2 Antibody (NBP1-89462)

Discover more about diseases related to HIPK2 Antibody (NBP1-89462).
 

Pathways for HIPK2 Antibody (NBP1-89462)

View related products by pathway.

PTMs for HIPK2 Antibody (NBP1-89462)

Learn more about PTMs related to HIPK2 Antibody (NBP1-89462).
 

Research Areas for HIPK2 Antibody (NBP1-89462)

Find related products by research area.

Blogs on HIPK2

There are no specific blogs for HIPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIPK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIPK2
Entrez