HIBADH Antibody - BSA Free

Western Blot: HIBADH Antibody [NBP1-82526] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human kidney.

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human kidney, liver, lymph node and placenta using Anti-HIBADH antibody NBP1-82526 (A) shows similar protein distribution across tissues to independent antibody NBP1-80985 (B).

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human liver.

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human placenta.

Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-82526] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HIBADH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HIBADH Antibody - BSA Free (NBP1-82526) is a polyclonal antibody validated for use in IHC and WB. Anti-HIBADH Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLR
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIBADH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HIBADH Protein (NBP1-82526PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23423614)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HIBADH Antibody - BSA Free

• 3-hydroxyisobutyrate dehydrogenase
• 3-hydroxyisobutyrate dehydrogenase, mitochondrial
• EC 1.1.1,3'-hydroxyisobutyrate dehydrogenase
• EC 1.1.1.31
• MGC40361
• NS5ATP1

Background

3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HIBADH Antibody (NBP1-82526)(1)

Publication using NBP1-82526

• Tasi YC, Chao HC, Chung CL et al. Characterization of 3-hydroxyisobutyrate dehydrogenase, HIBADH, as a sperm-motility marker. J Assist Reprod Genet 2013-04-01 [PMID: 23423614]

Bioinformatics

• Gene Symbol: HIBADH