HIBCH Antibody - BSA Free

Western Blot: HIBCH Antibody [NBP2-32669] - Analysis using Anti-HIBCH antibody NBP2-32669 (A) shows similar pattern to independent antibody NBP1-85891 (B).

Immunocytochemistry/Immunofluorescence: HIBCH Antibody [NBP2-32669] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining of human liver.

Western Blot: HIBCH Antibody [NBP2-32669] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-HIBCH antibody. Remaining relative intensity is presented.

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining in human kidney and skeletal muscle tissues using anti-HIBCH antibody. Corresponding HIBCH RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining of human colon, kidney, liver and skeletal muscle using Anti-HIBCH antibody NBP2-32669 (A) shows similar protein distribution across tissues to independent antibody NBP1-85891 (B).

Immunohistochemistry-Paraffin: HIBCH Antibody [NBP2-32669] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HIBCH Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIBCH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HIBCH Protein (NBP2-32669PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HIBCH Antibody - BSA Free

• 3-hydroxyisobutyryl-CoA hydrolase
• EC 3.1.2.4,3-hydroxyisobutyryl-coenzyme A hydrolase3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
• HIB-CoA hydrolase
• HIBYLCOAH
• HIBYL-CoA-H

Background

Beta-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) is responsible for the specific hydrolysis of HIBYL-CoA, a valine catabolite, as well as the hydrolysis of beta-hydroxypropionyl-CoA, an intermediate in a minor pathway of propionate metabolism.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HIBCH