HIBADH Antibody

Images

 
Western Blot: HIBADH Antibody [NBP1-80985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-80985] - Staining in human kidney and pancreas tissues using anti-HIBADH antibody. Corresponding HIBADH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-80985] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: HIBADH Antibody [NBP1-80985] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIBADH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMS
Specificity
Specificity of human HIBADH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIBADH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HIBADH Protein (NBP1-80985PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIBADH Antibody

  • 3-hydroxyisobutyrate dehydrogenase
  • 3-hydroxyisobutyrate dehydrogenase, mitochondrial
  • EC 1.1.1,3'-hydroxyisobutyrate dehydrogenase
  • EC 1.1.1.31
  • MGC40361
  • NS5ATP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF8125
Species: Hu, Mu
Applications: WB, Simple Western, IHC
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
H00023268-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46224
Species: Hu
Applications: WB, IHC
NBP1-80637
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02673
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF

Publications for HIBADH Antibody (NBP1-80985) (0)

There are no publications for HIBADH Antibody (NBP1-80985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIBADH Antibody (NBP1-80985) (0)

There are no reviews for HIBADH Antibody (NBP1-80985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIBADH Antibody (NBP1-80985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HIBADH Antibody (NBP1-80985)

Discover related pathways, diseases and genes to HIBADH Antibody (NBP1-80985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIBADH Antibody (NBP1-80985)

Discover more about diseases related to HIBADH Antibody (NBP1-80985).
 

Pathways for HIBADH Antibody (NBP1-80985)

View related products by pathway.

Blogs on HIBADH

There are no specific blogs for HIBADH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIBADH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIBADH