hHR23b Antibody


Western Blot: hHR23b Antibody [NBP1-89698] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: hHR23b Antibody [NBP1-89698] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human prostate shows strong nuclear and cytoplasmic membrane positivity in glandular cells.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human salivary gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human pancreas shows nuclear positivity.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human placenta shows nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human skin shows nuclear positivity in epidermal cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

hHR23b Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE
Specificity of human hHR23b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
hHR23b Lysate (NBP2-64888)
Control Peptide
hHR23b Protein (NBP1-89698PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for hHR23b Antibody

  • HHR23B
  • HR23BUV excision repair protein RAD23 homolog B
  • P58
  • RAD23 (S. cerevisiae) homolog B
  • RAD23 homolog B (S. cerevisiae)
  • RAD23, yeast homolog of, B
  • XP-C repair complementing complex 58 kDa
  • XP-C repair complementing protein
  • XP-C repair-complementing complex 58 kDa protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: Flow, Block, CyTOF-ready
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for hHR23b Antibody (NBP1-89698) (0)

There are no publications for hHR23b Antibody (NBP1-89698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hHR23b Antibody (NBP1-89698) (0)

There are no reviews for hHR23b Antibody (NBP1-89698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hHR23b Antibody (NBP1-89698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional hHR23b Products

Bioinformatics Tool for hHR23b Antibody (NBP1-89698)

Discover related pathways, diseases and genes to hHR23b Antibody (NBP1-89698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hHR23b Antibody (NBP1-89698)

Discover more about diseases related to hHR23b Antibody (NBP1-89698).

Pathways for hHR23b Antibody (NBP1-89698)

View related products by pathway.

PTMs for hHR23b Antibody (NBP1-89698)

Learn more about PTMs related to hHR23b Antibody (NBP1-89698).

Research Areas for hHR23b Antibody (NBP1-89698)

Find related products by research area.

Blogs on hHR23b

There are no specific blogs for hHR23b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our hHR23b Antibody and receive a gift card or discount.


Gene Symbol RAD23B