hHR23b Antibody - BSA Free

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human colon, kidney, liver and testis using Anti-RAD23B antibody NBP1-89698 (A) shows similar protein distribution across tissues to independent antibody NBP1-89699 (B).

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human testis using Anti-RAD23B antibody NBP1-89698.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human pancreas shows nuclear positivity.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human skin shows nuclear positivity in epidermal cells.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts and in Leydig cells.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human colon.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human liver.

Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89698] - Staining of human kidney.

Analysis in human cell line A-549.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hHR23b Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAD23B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  hHR23b Protein (NBP1-89698PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for hHR23b Antibody - BSA Free

• HHR23B
• HR23BUV excision repair protein RAD23 homolog B
• P58
• RAD23 (S. cerevisiae) homolog B
• RAD23 homolog B (S. cerevisiae)
• RAD23, yeast homolog of, B
• XP-C repair complementing complex 58 kDa
• XP-C repair complementing protein
• XP-C repair-complementing complex 58 kDa protein

Background

hHR23b is encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAD23B