HHATL Antibody

Images

 
Immunohistochemistry: HHATL Antibody [NBP1-86791] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HHATL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HHATL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HHATL Protein (NBP1-86791PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HHATL Antibody

  • C3orf3
  • chromosome 3 open reading frame 3
  • glycerol uptake/transporter homolog
  • GUP1
  • Hedgehog acyltransferase-like protein
  • hedgehog acyltransferase-like
  • KIAA1173GUP1, glycerol uptake/transporter homolog (yeast)
  • MBOAT3
  • membrane bound O-acyltransferase domain containing 3
  • protein-cysteine N-palmitoyltransferase HHAT-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-14089
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86121
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HHATL Antibody (NBP1-86791) (0)

There are no publications for HHATL Antibody (NBP1-86791).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HHATL Antibody (NBP1-86791) (0)

There are no reviews for HHATL Antibody (NBP1-86791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HHATL Antibody (NBP1-86791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HHATL Products

Bioinformatics Tool for HHATL Antibody (NBP1-86791)

Discover related pathways, diseases and genes to HHATL Antibody (NBP1-86791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HHATL Antibody (NBP1-86791)

Discover more about diseases related to HHATL Antibody (NBP1-86791).

Blogs on HHATL

There are no specific blogs for HHATL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HHATL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HHATL