![Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/HHAT-Antibody-Western-Blot-NBP1-69465-img0002.jpg "Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to HHAT(hedgehog acyltransferase) The peptide sequence was selected from the N terminal of human HHAT (NP_060664). Peptide sequence MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HHAT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against HHAT and was validated on Western blot. |
|
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP1-47842-img0019.jpg)
-Immunoprecipitation-NBP1-47842-img0023.jpg)
-Immunohistochemistry-Paraffin-NBP1-47842-img0003.jpg)
-NB600-600-img0002.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Publication using NBP1-69465 | Applications | Species |
|---|---|---|
| Huang C, Lu H, Li J et al. SOX2 regulates radioresistance in cervical cancer via the hedgehog signaling pathway Gynecol. Oncol. 2018-10-15 [PMID: 30336948] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for HHAT Antibody (NBP1-69465)Discover more about diseases related to HHAT Antibody (NBP1-69465).
| Pathways for HHAT Antibody (NBP1-69465)View related products by pathway.
|
PTMs for HHAT Antibody (NBP1-69465)Learn more about PTMs related to HHAT Antibody (NBP1-69465).
| Research Areas for HHAT Antibody (NBP1-69465)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: HHAT Antibody [NBP1-69465] - This Anti-HHAT antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize2/HHAT-Antibody-Western-Blot-NBP1-69465-img0001.jpg "Western Blot: HHAT Antibody [NBP1-69465] - This Anti-HHAT antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.")
![Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize2/HHAT-Antibody-Western-Blot-NBP1-69465-img0003.jpg "Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SHCF_2841.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_CF_342.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-shcf_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-cf-sec-mals-1042023155813.jpg)
-Immunocytochemistry-NBP1-47945-img0013.jpg)
-Immunohistochemistry-Paraffin-NBP1-47945-img0014.jpg)
-Immunohistochemistry-Paraffin-NBP1-47945-img0015.jpg)
-Western-Blot-H00003077-M01-img0009.jpg)
-Immunocytochemistry-Immunofluorescence-H00003077-M01-img0006.jpg)
-Western-Blot-H00003077-M01-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")