HHAT Antibody


Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: HHAT Antibody [NBP1-69465] - This Anti-HHAT antibody was used in Western Blot of HT1080 tissue lysate at a concentration of 1ug/ml.
Western Blot: HHAT Antibody [NBP1-69465] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HHAT Antibody Summary

Synthetic peptides corresponding to HHAT(hedgehog acyltransferase) The peptide sequence was selected from the N terminal of human HHAT (NP_060664). Peptide sequence MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HHAT and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HHAT Antibody

  • EC 2.3.1.-
  • FLJ10724
  • FLJ34867
  • GUP2
  • hedgehog acyltransferaserasp
  • HHAT
  • MART2
  • MART-2
  • MART2sit
  • melanoma antigen recognized by T cells 2
  • Melanoma antigen recognized by T-cells 2
  • protein-cysteine N-palmitoyltransferase HHAT
  • SKI1
  • SKI1ski
  • Skinny hedgehog protein 1
  • Skinny Hedgehog
  • Skn


Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for HHAT Antibody (NBP1-69465) (0)

There are no publications for HHAT Antibody (NBP1-69465).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HHAT Antibody (NBP1-69465) (0)

There are no reviews for HHAT Antibody (NBP1-69465). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HHAT Antibody (NBP1-69465) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HHAT Products

Bioinformatics Tool for HHAT Antibody (NBP1-69465)

Discover related pathways, diseases and genes to HHAT Antibody (NBP1-69465). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HHAT Antibody (NBP1-69465)

Discover more about diseases related to HHAT Antibody (NBP1-69465).

Pathways for HHAT Antibody (NBP1-69465)

View related products by pathway.

PTMs for HHAT Antibody (NBP1-69465)

Learn more about PTMs related to HHAT Antibody (NBP1-69465).

Blogs on HHAT

There are no specific blogs for HHAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HHAT Antibody and receive a gift card or discount.


Gene Symbol HHAT