Home » HGS » HGS Antibodies » HGS Antibody (6D11)

HGS Antibody (6D11)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.
Immunocytochemistry/ Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected ...read more
Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, S-ELISA, KD
Clone
6D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HGS Antibody (6D11) Summary

Immunogen
HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Specificity
HGS - hepatocyte growth factor-regulated tyrosine kinase substrate
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HGS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.
Publications
Read Publications using H00009146-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGS Antibody (6D11)

  • FLJ39878
  • hepatocyte growth factor-regulated tyrosine kinase substrate
  • Hrs
  • HRSFLJ11421
  • human growth factor-regulated tyrosine kinase substrate
  • Protein pp110
  • Vps27
  • ZFYVE8

Background

HGS is involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early end

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
STAM-1 Antibody
NBP2-38514
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(668 Publications)
Species: Hu
Applications: BA
TSG101 Antibody
(4A10)
NB200-112
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on HeLa cells with TSG101 Antibody (4A10) NB200-112F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on Hek293 cells with TSG101 Antibody [4A10] NB200-112PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(89 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Hairless Antibody
[Unconjugated]
AF5708
Western blot shows lysates of HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Hairless at approximately 96 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Hairless was detected in immersion fixed human NHEK epidermal keratinocytes using 10 µg/mL Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: ICC, WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of mouse testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein with no signal in other cell types.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
(2 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
STAM2 Antibody
NBP1-83289
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Analysis in human testis and skeletal muscle tissues. Corresponding STAM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human skeletal muscle shows very weak positivity in myocytes.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
NF2/Merlin Antibody
NBP1-87757
Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in control (vector only transfected HEK293T lysate) and SNAP25 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Staining of human cerebral cortex shows strong positivity in neuropil.
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
HGF [Unconjugated]
294-HG/CF
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(102 Publications)
Species: Hu
Applications: BA
CBL Antibody (3B12)
NBP2-37574
ELISA: CBL Antibody (3B12) [NBP2-37574] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mAb against human C-CBL (AA: 684-865) recombinant protein. (Expected MW is 44.9 kDa)
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
EPS15 Antibody
(1261C) [Unconjugated
MAB8480
U‑118‑MG human glioblastoma/astrocytoma cell line was stained with Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480, filled histogram) or isotype control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012). View our protocol for Staining Intracellular Molecules.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A431 human epithelial carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Eps15 at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Eps15 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
TOM1 Antibody
NBP1-86170
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
D6050
(700 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
ZFYVE9 GST (N-Term) P ...
H00009372-P02
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
Species: Hu
Applications: ELISA, AP, PA, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP3-15744
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - Western blot analysis of Human Cell line lysates showing detection of Rab5aprotein using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Load: 15 ugprotein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunohistochemistry: Rab5a Antibody [NB120-13253] - Immunohistochemistry analysis using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative Solution. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody . Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(14 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(349 Publications)
Species: Hu
Applications: BA

Publications for HGS Antibody (H00009146-M01)(2)


Reviews for HGS Antibody (H00009146-M01) (0)

There are no reviews for HGS Antibody (H00009146-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGS Antibody (H00009146-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HGS Products

Array H00009146-M01

Bioinformatics Tool for HGS Antibody (H00009146-M01)

Discover related pathways, diseases and genes to HGS Antibody (H00009146-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGS Antibody (H00009146-M01)

Discover more about diseases related to HGS Antibody (H00009146-M01).
 

Pathways for HGS Antibody (H00009146-M01)

View related products by pathway.

PTMs for HGS Antibody (H00009146-M01)

Learn more about PTMs related to HGS Antibody (H00009146-M01).
 

Research Areas for HGS Antibody (H00009146-M01)

Find related products by research area.

Blogs on HGS

There are no specific blogs for HGS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGS Antibody (6D11) and receive a gift card or discount.


Bioinformatics

Gene Symbol HGS
Entrez
OMIM
Uniprot