HGS Antibody (6D11)

Images

 
Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.
Immunocytochemistry/ Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected ...read more
Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
Clone
6D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HGS Antibody (6D11) Summary

Immunogen
HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Specificity
HGS - hepatocyte growth factor-regulated tyrosine kinase substrate
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HGS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.
Publications
Read Publications using H00009146-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGS Antibody (6D11)

  • FLJ39878
  • hepatocyte growth factor-regulated tyrosine kinase substrate
  • Hrs
  • HRSFLJ11421
  • human growth factor-regulated tyrosine kinase substrate
  • Protein pp110
  • Vps27
  • ZFYVE8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Pm, Pm
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5708
Species: Hu
Applications: WB, ICC
NBP2-36568
Species: Hu, Mu
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-86170
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93525
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl

Publications for HGS Antibody (H00009146-M01)(2)

Reviews for HGS Antibody (H00009146-M01) (0)

There are no reviews for HGS Antibody (H00009146-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGS Antibody (H00009146-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HGS Products

Array H00009146-M01

Bioinformatics Tool for HGS Antibody (H00009146-M01)

Discover related pathways, diseases and genes to HGS Antibody (H00009146-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGS Antibody (H00009146-M01)

Discover more about diseases related to HGS Antibody (H00009146-M01).
 

Pathways for HGS Antibody (H00009146-M01)

View related products by pathway.

PTMs for HGS Antibody (H00009146-M01)

Learn more about PTMs related to HGS Antibody (H00009146-M01).
 

Research Areas for HGS Antibody (H00009146-M01)

Find related products by research area.

Blogs on HGS

There are no specific blogs for HGS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGS Antibody (6D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HGS
Entrez
OMIM
Uniprot