Home » HGS » HGS Antibodies » HGS Antibody (6D11)

HGS Antibody (6D11)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.
Immunocytochemistry/ Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected ...read more
Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
Clone
6D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HGS Antibody (6D11) Summary

Immunogen
HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Specificity
HGS - hepatocyte growth factor-regulated tyrosine kinase substrate
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HGS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.
Publications
Read Publications using H00009146-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGS Antibody (6D11)

  • FLJ39878
  • hepatocyte growth factor-regulated tyrosine kinase substrate
  • Hrs
  • HRSFLJ11421
  • human growth factor-regulated tyrosine kinase substrate
  • Protein pp110
  • Vps27
  • ZFYVE8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(4 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
STAM-1 Antibody
NBP2-38514
Western Blot: STAM-1 Antibody [NBP2-38514] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/Immunofluorescence: STAM-1 Antibody [NBP2-38514] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human bone marrow shows distinct cytoplasmic positivity in subsets of hematopoietic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(457 Publications)
Species: Hu
TSG101 Antibody
(4A10)
NB200-112
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Characterization of exosomes. Western blot analysis of exosomes revealed differential expression of TSG101 between HCT116-R exosomes and HCT116-P exosomes. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-53063-y), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TSG101 Antibody (4A10) [NB200-112] - TSG101 antibody [4A10] detects TSG101 protein at cytoplasm by immunohistochemical analysis.Sample: Paraffin-embedded human ovarian cancer.TSG101 stained by TSG101 antibody [4A10] (NB200-112).Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - TSG101 antibody [4A10] (NB200-112) detects TSG101 protein by flow cytometry analysis.Sample: THP-1 cell.Black: Unlabelled sample was used as a control.Red: TSG101 antibody [4A10] (NB200-112).Acquisition of 20,000 events were collected using a Dylight 488-conjugated secondary antibody for FACS analysis.
(2 Reviews)
(80 Publications)
Species: Hu, Mu, Rt, Ha, Pm, Pm
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Hairless Antibody
[Unconjugated]
AF5708
Western blot shows lysates of HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Hairless at approximately 96 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Hairless was detected in immersion fixed human NHEK epidermal keratinocytes using 10 µg/mL Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, ICC
EEA1 Antibody
(6D4.1D4)
NBP2-36568
Western Blot: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of partial recombinant human EEA1 protein (14kDa) with EEA1 antibody clone 6D4.1D4 at 0.5 ug mL.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, Flow-IC
STAM2 Antibody
NBP1-83289
Western Blot: STAM2 Antibody [NBP1-83289] - Analysis using Anti-STAM2 antibody NBP1-83289 (A) shows similar pattern to independent antibody NBP1-83288 (B).
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Analysis in human testis and skeletal muscle tissues. Corresponding STAM2 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
NF2/Merlin Antibody
NBP1-87757
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in mouse cerebral cortex tissue.
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Analysis in human cerebral cortex and testis tissues using NBP1-88769 antibody. Corresponding SNAP25 RNA-seq data are presented for the same tissues.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
(4 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
HGF [Unconjugated]
294-HG
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(4 Reviews)
(83 Publications)
Species: Hu
CBL Antibody (3B12)
NBP2-37574
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
Immunocytochemistry/Immunofluorescence: CBL Antibody (3B12) [NBP2-37574] - Immunofluorescence analysis of Hela cells using C-CBL mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: CBL Antibody (3B12) [NBP2-37574] - Analysis of cancer tissues using C-CBL mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
EPS15 Antibody
(1261C) [Unconjugated
MAB8480
U‑118‑MG human glioblastoma/astrocytoma cell line was stained with Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480, filled histogram) or isotype control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012). View our protocol for Staining Intracellular Molecules.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A431 human epithelial carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Eps15 at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Eps15 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Rabbit Anti-Human Eps15 Monoclonal Antibody (Catalog # MAB8480) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
TOM1 Antibody
NBP1-86170
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
ZFYVE9 Antibody
NBP2-93525
Western Blot: ZFYVE9 Antibody [NBP2-93525] - Analysis of extracts of various cell lines, using ZFYVE9 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 20s.
Immunocytochemistry/Immunofluorescence: ZFYVE9 Antibody [NBP2-93525] - Analysis of HeLa cells using ZFYVE9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Rt
Applications: WB, ICC/IF
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP2-89114
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in SiHa cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:200 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Analysis of paraffin-embedded human kidney tissue using anti-Acetyl CoA Carboxylase 1 (ACC1) antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/200 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in MCF-7 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:100 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - analysis of Human Cell line lysates showing detection of Rab5 protein using Rabbit Anti-Rab5 Polyclonal Antibody. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rab5a Antibody [NB120-13253] - Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:80 for 12 hours at 4C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 2 hours at RT. Localization: Cytoplasm. Melanosome. Nucleus. Magnification: 100x.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu

Publications for HGS Antibody (H00009146-M01)(2)


Reviews for HGS Antibody (H00009146-M01) (0)

There are no reviews for HGS Antibody (H00009146-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGS Antibody (H00009146-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HGS Products

Array H00009146-M01

Bioinformatics Tool for HGS Antibody (H00009146-M01)

Discover related pathways, diseases and genes to HGS Antibody (H00009146-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGS Antibody (H00009146-M01)

Discover more about diseases related to HGS Antibody (H00009146-M01).
 

Pathways for HGS Antibody (H00009146-M01)

View related products by pathway.

PTMs for HGS Antibody (H00009146-M01)

Learn more about PTMs related to HGS Antibody (H00009146-M01).
 

Research Areas for HGS Antibody (H00009146-M01)

Find related products by research area.

Blogs on HGS

There are no specific blogs for HGS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGS Antibody (6D11) and receive a gift card or discount.


Bioinformatics

Gene Symbol HGS
Entrez
OMIM
Uniprot