HGK/MAP4K4 Antibody

Images

 
Immunohistochemistry-Paraffin: HGK/MAP4K4 Antibody [NBP1-84663] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HGK/MAP4K4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4K4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
HGK/MAP4K4 Protein (NBP1-84663PEP)
Publications
Read Publication using
NBP1-84663 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HGK/MAP4K4 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • FLH21957
  • FLJ10410
  • hepatocyte progenitor kinase-like/germinal center kinase-like kinase
  • HGK
  • HGKFLJ20373
  • HPK/GCK-like kinase HGK
  • KIAA0687
  • MAP4K4
  • MAPK/ERK kinase kinase kinase 4
  • MEK kinase kinase 4
  • MEKKK 4
  • MEKKK4
  • mitogen-activated protein kinase kinase kinase kinase 4
  • Nck-interacting kinase
  • NIKFLJ90111

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for HGK/MAP4K4 Antibody (NBP1-84663)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HGK/MAP4K4 Antibody (NBP1-84663) (0)

There are no reviews for HGK/MAP4K4 Antibody (NBP1-84663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HGK/MAP4K4 Antibody (NBP1-84663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HGK/MAP4K4 Products

Bioinformatics Tool for HGK/MAP4K4 Antibody (NBP1-84663)

Discover related pathways, diseases and genes to HGK/MAP4K4 Antibody (NBP1-84663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGK/MAP4K4 Antibody (NBP1-84663)

Discover more about diseases related to HGK/MAP4K4 Antibody (NBP1-84663).
 

Pathways for HGK/MAP4K4 Antibody (NBP1-84663)

View related products by pathway.

PTMs for HGK/MAP4K4 Antibody (NBP1-84663)

Learn more about PTMs related to HGK/MAP4K4 Antibody (NBP1-84663).
 

Research Areas for HGK/MAP4K4 Antibody (NBP1-84663)

Find related products by research area.

Blogs on HGK/MAP4K4

There are no specific blogs for HGK/MAP4K4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGK/MAP4K4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K4
Entrez