HFM1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HFM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Predicted cross-reactivity based on sequence identity: Mouse 79%, Rat 69%.
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HFM1 Antibody
Background
The HFM1 gene encodes a probable ATP-dependent DNA helicase HFM1 that in isoform 1 is 1,435 amino acids long, 162 kDA, and in isoform 2 is 551 amino acids long at 62 kDA. It is known to interact with genes HSPH1, EXOSC10, EEF2, ENO3, and PLRG1. HFM1 has been researched regarding its role in tuberculosis, hemiplegia, epicondylitis, spastic hemiplegia, and fukuyama congenital muscular dystrophy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for HFM1 Antibody (NBP2-38228) (0)
There are no publications for HFM1 Antibody (NBP2-38228).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HFM1 Antibody (NBP2-38228) (0)
There are no reviews for HFM1 Antibody (NBP2-38228).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HFM1 Antibody (NBP2-38228) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HFM1 Products
Research Areas for HFM1 Antibody (NBP2-38228)
Find related products by research area.
|
Blogs on HFM1