HFM1 Antibody

Staining of human cell line AF22 shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HFM1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HFM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Predicted cross-reactivity based on sequence identity: Mouse 79%, Rat 69%.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HFM1 Antibody

• FLJ39011
• helicase-like protein HFM1
• HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
• probable ATP-dependent DNA helicase HFM1
• RP11-539G11.1

Background

The HFM1 gene encodes a probable ATP-dependent DNA helicase HFM1 that in isoform 1 is 1,435 amino acids long, 162 kDA, and in isoform 2 is 551 amino acids long at 62 kDA. It is known to interact with genes HSPH1, EXOSC10, EEF2, ENO3, and PLRG1. HFM1 has been researched regarding its role in tuberculosis, hemiplegia, epicondylitis, spastic hemiplegia, and fukuyama congenital muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HFM1
• Uniprot:
  • A2PYH4(Human)