HEY1 Antibody [Janelia Fluor® 669]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Janelia Fluor 669

HEY1 Antibody [Janelia Fluor® 669] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).
  
  Sequence:
  IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for HEY1 Antibody [Janelia Fluor® 669]

• basic helix-loop-helix protein OAF1
• BHLHb31
• Cardiovascular helix-loop-helix factor 2
• CHF-2
• CHF2hHRT1
• Class B basic helix-loop-helix protein 31
• Hairy and enhancer of split-related protein 1
• hairy/enhancer-of-split related with YRPW motif 1
• hairy/enhancer-of-split related with YRPW motif protein 1
• Hairy-related transcription factor 1
• HERP2HES-related repressor protein 1
• HESR-1
• HESR1MGC1274
• HES-related repressor protein 2
• HRT1
• HRT-1OAF1

Background

Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. Hey1 functions as a corepressor, providing a mechanism of cross-talk between Notch and androgen signaling pathways. It is excluded from the nucleus in most human prostate cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HEY1