HEY1 Antibody [CoraFluor™ 1]

Product Discontinued

HEY1 Antibody [CoraFluor™ 1] Summary

• Description: CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
  
  CoraFluor(TM) 1, amine reactive
  
  CoraFluor(TM) 1, thiol reactive
  
  For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).
  
  Sequence:
  IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for HEY1 Antibody [CoraFluor™ 1]

• basic helix-loop-helix protein OAF1
• BHLHb31
• Cardiovascular helix-loop-helix factor 2
• CHF-2
• CHF2hHRT1
• Class B basic helix-loop-helix protein 31
• Hairy and enhancer of split-related protein 1
• hairy/enhancer-of-split related with YRPW motif 1
• hairy/enhancer-of-split related with YRPW motif protein 1
• Hairy-related transcription factor 1
• HERP2HES-related repressor protein 1
• HESR-1
• HESR1MGC1274
• HES-related repressor protein 2
• HRT1
• HRT-1OAF1

Background

Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. Hey1 functions as a corepressor, providing a mechanism of cross-talk between Notch and androgen signaling pathways. It is excluded from the nucleus in most human prostate cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HEY1