Hey L Antibody - BSA Free

Immunohistochemistry-Paraffin: Hey L Antibody [NBP2-69029] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hey L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Hey L Antibody - BSA Free (NBP2-69029) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGII
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEYL
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Hey L Recombinant Protein Antigen (NBP2-69029PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Hey L Antibody - BSA Free

• BHLHB33
• bHLHb33hHeyL
• Class B basic helix-loop-helix protein 33
• hairy/enhancer-of-split related with YRPW motif 3
• hairy/enhancer-of-split related with YRPW motif-like protein
• hairy/enhancer-of-split related with YRPW motif-like
• Hairy-related transcription factor 3
• HEY3
• HEY-like protein
• hHRT3
• HRT3
• HRT-3
• MGC12623

Background

Hey L encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HEYL