Hexokinase 2 Antibody - BSA Free

Western Blot: Hexokinase 2 Antibody [NBP1-90922] - Analysis in human cell line U-87 MG.

Analysis in human cell line U-87 MG.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Hexokinase 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Hexokinase 2 Antibody - BSA Free (NBP1-90922) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  Hexokinase 2 Protein (NBP1-90922PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hexokinase 2 Antibody - BSA Free

• DKFZp686M1669
• EC 2.7.1
• Hexokinase 2
• Hexokinase type II
• HK2
• HKII
• HXK2
• Muscle form hexokinase
• muscle

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HK2