Hexokinase 2 Antibody

Images

 
Western Blot: Hexokinase 2 Antibody [NBP1-90922] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hexokinase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hexokinase 2 Protein (NBP1-90922PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hexokinase 2 Antibody

  • DKFZp686M1669
  • EC 2.7.1
  • Hexokinase 2
  • Hexokinase type II
  • HK2
  • HKII
  • HXK2
  • Muscle form hexokinase
  • muscle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no publications for Hexokinase 2 Antibody (NBP1-90922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no reviews for Hexokinase 2 Antibody (NBP1-90922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hexokinase 2 Products

Bioinformatics Tool for Hexokinase 2 Antibody (NBP1-90922)

Discover related pathways, diseases and genes to Hexokinase 2 Antibody (NBP1-90922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hexokinase 2 Antibody (NBP1-90922)

Discover more about diseases related to Hexokinase 2 Antibody (NBP1-90922).
 

Pathways for Hexokinase 2 Antibody (NBP1-90922)

View related products by pathway.

PTMs for Hexokinase 2 Antibody (NBP1-90922)

Learn more about PTMs related to Hexokinase 2 Antibody (NBP1-90922).
 

Research Areas for Hexokinase 2 Antibody (NBP1-90922)

Find related products by research area.

Blogs on Hexokinase 2

There are no specific blogs for Hexokinase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hexokinase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HK2
Entrez