Hexokinase 2 Antibody


Western Blot: Hexokinase 2 Antibody [NBP1-90922] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: Hexokinase 2 Antibody [NBP1-90922] - Staining in human epididymis and pancreas tissues using anti-HK2 antibody. Corresponding HK2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Hexokinase 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA
Specificity of human Hexokinase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hexokinase 2 Protein (NBP1-90922PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Hexokinase 2 Antibody

  • DKFZp686M1669
  • EC 2.7.1
  • Hexokinase 2
  • Hexokinase type II
  • HK2
  • HKII
  • HXK2
  • Muscle form hexokinase
  • muscle


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no publications for Hexokinase 2 Antibody (NBP1-90922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no reviews for Hexokinase 2 Antibody (NBP1-90922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hexokinase 2 Antibody (NBP1-90922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Hexokinase 2 Products

Bioinformatics Tool for Hexokinase 2 Antibody (NBP1-90922)

Discover related pathways, diseases and genes to Hexokinase 2 Antibody (NBP1-90922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hexokinase 2 Antibody (NBP1-90922)

Discover more about diseases related to Hexokinase 2 Antibody (NBP1-90922).

Pathways for Hexokinase 2 Antibody (NBP1-90922)

View related products by pathway.

PTMs for Hexokinase 2 Antibody (NBP1-90922)

Learn more about PTMs related to Hexokinase 2 Antibody (NBP1-90922).

Research Areas for Hexokinase 2 Antibody (NBP1-90922)

Find related products by research area.

Blogs on Hexokinase 2

There are no specific blogs for Hexokinase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hexokinase 2 Antibody and receive a gift card or discount.


Gene Symbol HK2