HERC4 Antibody

Images

 
Western Blot: HERC4 Antibody [NBP2-56037] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: HERC4 Antibody [NBP2-56037] - Staining of human cell line A-431 shows localization to nucleoli fibrillar center & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HERC4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQV
Specificity
Specificity of human HERC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HERC4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
HERC4 Knockout HeLa Cell Lysate
Control Peptide
HERC4 Recombinant Protein Antigen (NBP2-56037PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HERC4 Antibody

  • DKFZP564G092
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT domain and RCC1-like domain-containing protein 4
  • hect domain and RLD 4
  • KIAA1593probable E3 ubiquitin-protein ligase HERC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-56484
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
AF7034
Species: Hu
Applications: WB
NBP2-13602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-00348
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF8014
Species: Hu
Applications: IHC
NBP1-55025
Species: Hu
Applications: WB
NBP1-57718
Species: Hu
Applications: WB
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-34717
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-56037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for HERC4 Antibody (NBP2-56037) (0)

There are no publications for HERC4 Antibody (NBP2-56037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC4 Antibody (NBP2-56037) (0)

There are no reviews for HERC4 Antibody (NBP2-56037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HERC4 Antibody (NBP2-56037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HERC4 Products

Array NBP2-56037

Bioinformatics Tool for HERC4 Antibody (NBP2-56037)

Discover related pathways, diseases and genes to HERC4 Antibody (NBP2-56037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC4 Antibody (NBP2-56037)

Discover more about diseases related to HERC4 Antibody (NBP2-56037).
 

Pathways for HERC4 Antibody (NBP2-56037)

View related products by pathway.

PTMs for HERC4 Antibody (NBP2-56037)

Learn more about PTMs related to HERC4 Antibody (NBP2-56037).

Blogs on HERC4

There are no specific blogs for HERC4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC4