After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Biological Strategies: Western Blot: DNAJC12 Antibody [NBP1-57718] - Protein expression validation of RNA-seq results in DTX-sensitive and DTX-resistant mCRPC cells. Representative Western blot images and protein ...read more
Protein expression validation of RNA-seq results in DTX-sensitive and DTX-resistant mCRPC cellsRepresentative Western blot images and protein fold change quantification are shown for (A) DPP4 (n= 3), (B) TSPAN8 (n= 4), ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to DNAJC12 (DnaJ (Hsp40) homolog, subfamily C, member 12) The peptide sequence was selected from the middle region of DNAJC12)(50ug). Peptide sequence EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for DNAJC12 Antibody - BSA Free
DnaJ (Hsp40) homolog, subfamily C, member 12
dnaJ homolog subfamily C member 12
J domain containing protein 1 (JDP1)
J domain protein 1
JDP1J domain-containing protein 1
Background
This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our DNAJC12 Antibody - BSA Free and receive a gift card or discount.