DNAJC12 Antibody

Western Blot: DNAJC12 Antibody [NBP1-57718] - Protein expression validation of RNA-seq results in DTX-sensitive and DTX-resistant mCRPC cells. Representative Western blot images and protein fold change quantification are shown for DNAJC12 antibody (n= 4) *P< 0.05; **P< 0.05; ***P< 0.001. All proteins were analyzed in at least three independent experiments. Error bars represent mean +/- SD. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/article/25744/text/) licensed under a CC-BY licence.

Western Blot: DNAJC12 Antibody [NBP1-57718] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNAJC12 Antibody Summary

• Immunogen: Synthetic peptides corresponding to DNAJC12 (DnaJ (Hsp40) homolog, subfamily C, member 12) The peptide sequence was selected from the middle region of DNAJC12)(50ug). Peptide sequence EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against DNAJC12 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNAJC12 Antibody

• DnaJ (Hsp40) homolog, subfamily C, member 12
• dnaJ homolog subfamily C member 12
• J domain containing protein 1 (JDP1)
• J domain protein 1
• JDP1J domain-containing protein 1

Background

This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNAJC12 Antibody (NBP1-57718)(1)

Publication using NBP1-57718

• Cajigas-Du Ross CK, Martinez SR, Woods-Burnham L et al. RNA sequencing reveals upregulation of a transcriptomic program associated with stemness in metastatic prostate cancer cells selected for taxane resistance Oncotarget 2018-07-13 [PMID: 30100995] (WB, Human)

Bioinformatics

• Gene Symbol: DNAJC12
• Uniprot:
  • Q9UKB3(Human)