DNAJC12 Antibody

Images

 
Western Blot: DNAJC12 Antibody [NBP1-57718] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC12 Antibody Summary

Immunogen
Synthetic peptides corresponding to DNAJC12 (DnaJ (Hsp40) homolog, subfamily C, member 12) The peptide sequence was selected from the middle region of DNAJC12)(50ug). Peptide sequence EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DNAJC12 and was validated on Western blot.
Publications
Read Publication using
NBP1-57718 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNAJC12 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 12
  • dnaJ homolog subfamily C member 12
  • J domain containing protein 1 (JDP1)
  • J domain protein 1
  • JDP1J domain-containing protein 1

Background

This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: ICC/IF (-), WB, ELISA
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00148327-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, RNAi
NBP1-92275
Species: Hu
Applications: IHC, IHC-P

Publications for DNAJC12 Antibody (NBP1-57718)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DNAJC12 Antibody (NBP1-57718) (0)

There are no reviews for DNAJC12 Antibody (NBP1-57718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC12 Antibody (NBP1-57718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC12 Products

Bioinformatics Tool for DNAJC12 Antibody (NBP1-57718)

Discover related pathways, diseases and genes to DNAJC12 Antibody (NBP1-57718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC12 Antibody (NBP1-57718)

Discover more about diseases related to DNAJC12 Antibody (NBP1-57718).
 

Pathways for DNAJC12 Antibody (NBP1-57718)

View related products by pathway.

PTMs for DNAJC12 Antibody (NBP1-57718)

Learn more about PTMs related to DNAJC12 Antibody (NBP1-57718).

Blogs on DNAJC12

There are no specific blogs for DNAJC12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC12
Uniprot