Hemoglobin zeta Recombinant Protein Antigen

Images

 
There are currently no images for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

Hemoglobin zeta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hemoglobin zeta.

Source: E. coli

Amino Acid Sequence: TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HBZ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68924.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hemoglobin zeta Recombinant Protein Antigen

  • HBAZ
  • HBZ
  • HBZ2
  • hemoglobin subunit zeta
  • Hemoglobin zeta chain
  • Hemoglobin zeta
  • hemoglobin, zeta
  • zeta-globin

Background

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
AF4439
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-43557
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-97766
Species: Hu
Applications: PEP-ELISA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DTSP10
Species: Hu
Applications: ELISA
MAB5526
Species: Hu, Mu
Applications: WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-68924PEP
Species: Hu
Applications: Binding Activity

Publications for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP) (0)

There are no publications for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP) (0)

There are no reviews for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hemoglobin zeta Products

Bioinformatics Tool for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP)

Discover related pathways, diseases and genes to Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP)

Discover more about diseases related to Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP).
 

Pathways for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP)

View related products by pathway.

PTMs for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP)

Learn more about PTMs related to Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP).
 

Research Areas for Hemoglobin zeta Recombinant Protein Antigen (NBP2-68924PEP)

Find related products by research area.

Blogs on Hemoglobin zeta

There are no specific blogs for Hemoglobin zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hemoglobin zeta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HBZ