Hemoglobin epsilon Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Hemoglobin epsilon Antibody - BSA Free (NBP2-84061) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Hemoglobin epsilon. Peptide sequence: AVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HBE1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Hemoglobin epsilon Antibody - BSA Free
Background
The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with twozeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together withtwo alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal,and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in thefollowing order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3' (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Publications for Hemoglobin epsilon Antibody (NBP2-84061) (0)
There are no publications for Hemoglobin epsilon Antibody (NBP2-84061).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hemoglobin epsilon Antibody (NBP2-84061) (0)
There are no reviews for Hemoglobin epsilon Antibody (NBP2-84061).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hemoglobin epsilon Antibody (NBP2-84061) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hemoglobin epsilon Products
Research Areas for Hemoglobin epsilon Antibody (NBP2-84061)
Find related products by research area.
|
Blogs on Hemoglobin epsilon