HDAC1 Antibody (2L6O7)

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780] - Western blot analysis of extracts of various cell lines, using HDAC1 antibody (NBP3-15780) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780] - Western blot analysis of extracts from normal (control) and HDAC1 knockout (KO) 293T cells, using HDAC1 antibody (NBP3-15780) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: HDAC1 Antibody (2L6O7) [HDAC1] - Confocal imaging of HeLa cells using [KO Validated] HDAC1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunoprecipitation: HDAC1 Antibody (2L6O7) [HDAC1] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 0.5ug HDAC1 antibody . Western blot was performed from the immunoprecipitate using HDAC1 antibody at a dilition of 1:1000.

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clone: 2L6O7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HDAC1 Antibody (2L6O7) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit HDAC1 Antibody (2L6O7) (NBP3-15780) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC1 (Q13547). MTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HDAC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HDAC1 Antibody (2L6O7)

• EC 3.5.1.98
• GON-10
• HD1
• HD1DKFZp686H12203
• Histone Deacetylase 1
• KDAC1
• reduced potassium dependency, yeast homolog-like 1
• RPD3L1
• RPD3L1RPD3

Background

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HDAC1