HBP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HBP1 Antibody - BSA Free (NBP3-10947) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HBP1 (NP_036389). Peptide sequence FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HBP1 Antibody - BSA Free
Background
The HMG-box protein-1 (HBP1) is a member of the HMG family of transcription factors, which are characterized by the presence of a conserved protein motif, the high mobility group (HMG) 1 box, that mediates DNA binding. HBP1 binds to the tumor suppressor proteins Rb and p130 and initiates cell cycle arrest. Terminal cell differentiation requires this initial cell cycle arrest followed by the coordinated expression of genes defined as tissue-specifc markers. Along with initiating the commitment to cell differentiation, the continued activity of HBP1 abrogates the expression of tissue-specific genes by associating with the MyoD proteins. In muscle cell differentiation, the MyoD family of transcription factors, which include Myf5, MyoD and myogenein, induce the expression of these cell-type specific proteins and contribute to the development of cell phenotypes. The progression of terminal differentiation is, therefore, dependent on both a decrease in HBP1 activity and the corresponding activation of MyoD-induced gene transcription.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for HBP1 Antibody (NBP3-10947) (0)
There are no publications for HBP1 Antibody (NBP3-10947).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HBP1 Antibody (NBP3-10947) (0)
There are no reviews for HBP1 Antibody (NBP3-10947).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HBP1 Antibody (NBP3-10947) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HBP1 Products
Research Areas for HBP1 Antibody (NBP3-10947)
Find related products by research area.
|
Blogs on HBP1