HAX-1 Antibody

Images

 
Western Blot: HAX-1 Antibody [NBP2-57945] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: HAX-1 Antibody [NBP2-57945] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAX-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEA
Specificity
Specificity of human HAX-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HAX-1 Recombinant Protein Antigen (NBP2-57945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HAX-1 Antibody

  • FLJ17042
  • FLJ93803
  • HAX1
  • HAX-1
  • HCLS1 (and PKD2) associated protein
  • HCLS1 associated protein X-1
  • HCLS1-associated protein X-1
  • HCLSBP1
  • HS1 binding protein
  • HS1-associating protein X-1
  • HS1-binding protein 1
  • HS1BP1
  • HS1BP1FLJ18492
  • HSP1BP-1
  • SCN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
NBP2-19807
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-82857
Species: Hu
Applications: WB
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for HAX-1 Antibody (NBP2-57945) (0)

There are no publications for HAX-1 Antibody (NBP2-57945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAX-1 Antibody (NBP2-57945) (0)

There are no reviews for HAX-1 Antibody (NBP2-57945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HAX-1 Antibody (NBP2-57945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HAX-1 Products

Bioinformatics Tool for HAX-1 Antibody (NBP2-57945)

Discover related pathways, diseases and genes to HAX-1 Antibody (NBP2-57945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAX-1 Antibody (NBP2-57945)

Discover more about diseases related to HAX-1 Antibody (NBP2-57945).
 

Pathways for HAX-1 Antibody (NBP2-57945)

View related products by pathway.

PTMs for HAX-1 Antibody (NBP2-57945)

Learn more about PTMs related to HAX-1 Antibody (NBP2-57945).

Blogs on HAX-1

There are no specific blogs for HAX-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAX-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAX1