HAPLN4 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptide directed towards the C terminal of human HAPLN4The immunogen for this antibody is HAPLN4. Peptide sequence NYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HAPLN4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HAPLN4 Antibody - BSA Free
Background
The HAPLN4 gene codes for a hyaluronan and proteoglycan link protein 4 that may be involved in the creation of the extracellular matrix by binding to hyaluronic acid. The protein coded by HAPLN4 is 402 amino acids long at a mass of approximately 42 kDa. HAPLN$ is involved in MAPK signaling, PTEN pathway, and transendothelial migration of leukocytes. Researchers have investigated its role in malignant glioma and schizophrenia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, mIF
Species: Mu, Rt
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: WB
Species: Mu
Applications: WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Publications for HAPLN4 Antibody (NBP1-79323) (0)
There are no publications for HAPLN4 Antibody (NBP1-79323).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HAPLN4 Antibody (NBP1-79323) (0)
There are no reviews for HAPLN4 Antibody (NBP1-79323).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HAPLN4 Antibody (NBP1-79323) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HAPLN4 Products
Blogs on HAPLN4