HAPLN3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HAPLN3 Antibody [NBP1-83945] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HAPLN3 Antibody [NBP1-83945] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells, myoepithelial cells and extra cellular matrix.

Simple Western: Rabbit Polyclonal HAPLN3 Antibody [NBP1-83945] - HAPLN3 expression in human lung tissue. Tested in concentrations 1:10 and 1:20 in antibody diluent 2. The primary antibody incubation time was 1h. Image from a verified customer review.

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HAPLN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HAPLN3 Antibody - BSA Free (NBP1-83945) is a polyclonal antibody validated for use in IHC, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAPLN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western Validated for Simple Western from a verified customer review.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in Human lung tissue, separated by Size, antibody dilution of 1:10, 1:20, apparent MW was 40-45 kDa
• Control Peptide:

  HAPLN3 Protein (NBP1-83945PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HAPLN3 Antibody - BSA Free

• EXLD1
• extracellular link domain containing, 1
• HAPLN3
• HsT19883
• hyaluronan and proteoglycan link protein 3

Background

HAPLN3 belongs to the hyaluronan and proteoglycan binding link protein gene family. The protein encoded by this gene may function in hyaluronic acid binding and cell adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAPLN3