HAPLN3 Antibody


Immunocytochemistry/ Immunofluorescence: HAPLN3 Antibody [NBP1-83945] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HAPLN3 Antibody [NBP1-83945] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells, myoepithelial cells and extra cellular matrix.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

HAPLN3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
Specificity of human HAPLN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HAPLN3 Protein (NBP1-83945PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HAPLN3 Antibody

  • EXLD1
  • extracellular link domain containing, 1
  • HsT19883
  • hyaluronan and proteoglycan link protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for HAPLN3 Antibody (NBP1-83945) (0)

There are no publications for HAPLN3 Antibody (NBP1-83945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN3 Antibody (NBP1-83945) (0)

There are no reviews for HAPLN3 Antibody (NBP1-83945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HAPLN3 Antibody (NBP1-83945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HAPLN3 Products

Bioinformatics Tool for HAPLN3 Antibody (NBP1-83945)

Discover related pathways, diseases and genes to HAPLN3 Antibody (NBP1-83945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAPLN3 Antibody (NBP1-83945)

Discover more about diseases related to HAPLN3 Antibody (NBP1-83945).

Pathways for HAPLN3 Antibody (NBP1-83945)

View related products by pathway.

Blogs on HAPLN3

There are no specific blogs for HAPLN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HAPLN3 Antibody and receive a gift card or discount.


Gene Symbol HAPLN3