HAPLN3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HAPLN3 Antibody [NBP1-83945] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HAPLN3 Antibody [NBP1-83945] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells, myoepithelial cells and extra cellular matrix.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAPLN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPCRYRYEPALVSPRRVRVKWWKLSEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAPLN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HAPLN3 Protein (NBP1-83945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAPLN3 Antibody

  • EXLD1
  • extracellular link domain containing, 1
  • HsT19883
  • hyaluronan and proteoglycan link protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5800
Species: Mu, Rt
Applications: WB, IHC
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4085
Species: Hu
Applications: WB, IHC, IP
NBP1-91977
Species: Hu
Applications: WB, IHC, IHC-P
AF2608
Species: Hu
Applications: WB
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-83945
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HAPLN3 Antibody (NBP1-83945) (0)

There are no publications for HAPLN3 Antibody (NBP1-83945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN3 Antibody (NBP1-83945) (0)

There are no reviews for HAPLN3 Antibody (NBP1-83945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HAPLN3 Antibody (NBP1-83945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAPLN3 Products

Bioinformatics Tool for HAPLN3 Antibody (NBP1-83945)

Discover related pathways, diseases and genes to HAPLN3 Antibody (NBP1-83945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAPLN3 Antibody (NBP1-83945)

Discover more about diseases related to HAPLN3 Antibody (NBP1-83945).
 

Pathways for HAPLN3 Antibody (NBP1-83945)

View related products by pathway.

Blogs on HAPLN3

There are no specific blogs for HAPLN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAPLN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAPLN3