Novus Biologicals products are now on bio-techne.com

HAPLN2 Antibody

Images

 
Western Blot: HAPLN2 Antibody [NBP1-91977] - Analysis in control (vector only transfected HEK293T lysate) and HAPLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining in human cerebral cortex and kidney tissues using NBP1-91977 antibody. Corresponding HAPLN2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human cerebral cortex shows weak positivity in neuropil.
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human rectum shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HAPLN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAPLN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAPLN2 Protein (NBP1-91977PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAPLN2 Antibody

  • Brain link protein 1
  • brain link protein-1
  • BRAL1
  • HAPLN2
  • hyaluronan and proteoglycan link protein 2

Background

The 340 amino acid long, 37 kDA hyaluronan and proteoglycan link protein 2 encoded by the HAPLN2 gene monitors binding of versication V2 to hyaluronic acid. This protein may be a participant in the formation of the hyaluronan-associated matrix in the central nervous system (CNS). This matrix encourages neuronal confuction and structural stabilization. HAPLN2 participates in PTEN pathway, MAPK signaling, UPA-UPAR pathway, and transendothelial migration of leukocytes. It has been researched regarding its role in rabies, schizophrenia, neuronitis, and malignant glioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
AF3054
Species: Hu
Applications: ICC, IHC, WB
AF4085
Species: Hu
Applications: IHC, IP, WB
AF5800
Species: Mu, Rt
Applications: IHC, WB
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-83945
Species: Hu
Applications: ICC/IF, IHC, IHC-P
6140-ST
Species: Hu
Applications: EnzAct
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF7548
Species: Hu
Applications: IHC
MAB2688
Species: Hu
Applications: WB
NBP1-81828
Species: Hu
Applications: IHC, IHC-P
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for HAPLN2 Antibody (NBP1-91977) (0)

There are no publications for HAPLN2 Antibody (NBP1-91977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN2 Antibody (NBP1-91977) (0)

There are no reviews for HAPLN2 Antibody (NBP1-91977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAPLN2 Antibody (NBP1-91977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAPLN2 Products

Research Areas for HAPLN2 Antibody (NBP1-91977)

Find related products by research area.

Blogs on HAPLN2

There are no specific blogs for HAPLN2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAPLN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAPLN2