B3GAT2 Antibody


Western Blot: B3GAT2 Antibody [NBP1-68910] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

B3GAT2 Antibody Summary

Synthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against B3gat2 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GAT2 Antibody

  • beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
  • Beta-1,3-glucuronyltransferase 2
  • EC
  • GlcAT-D
  • GlcAT-S
  • GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
  • Glucuronosyltransferase S
  • KIAA1963glcAT-D
  • MGC138535
  • UDP-glucuronosyltransferase S
  • UDP-glucuronyltransferase S
  • uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase


B3gat2 is involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for B3GAT2 Antibody (NBP1-68910) (0)

There are no publications for B3GAT2 Antibody (NBP1-68910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GAT2 Antibody (NBP1-68910) (0)

There are no reviews for B3GAT2 Antibody (NBP1-68910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GAT2 Antibody (NBP1-68910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional B3GAT2 Products

Bioinformatics Tool for B3GAT2 Antibody (NBP1-68910)

Discover related pathways, diseases and genes to B3GAT2 Antibody (NBP1-68910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GAT2 Antibody (NBP1-68910)

Discover more about diseases related to B3GAT2 Antibody (NBP1-68910).

Pathways for B3GAT2 Antibody (NBP1-68910)

View related products by pathway.

PTMs for B3GAT2 Antibody (NBP1-68910)

Learn more about PTMs related to B3GAT2 Antibody (NBP1-68910).

Blogs on B3GAT2

There are no specific blogs for B3GAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our B3GAT2 Antibody and receive a gift card or discount.


Gene Symbol B3GAT2