HADHA Antibody

Images

 
Western Blot: HADHA Antibody [NBP2-54988] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: HADHA Antibody [NBP2-54988] - Staining of human cell line MCF7 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HADHA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK
Specificity
Specificity of human HADHA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
HADHA Knockout 293T Cell Lysate
Control Peptide

Reactivity Notes

Mouse 86%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HADHA Antibody

  • 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit
  • 3-oxoacyl-CoA thiolase
  • 78 kDa gastrin-binding protein
  • ECHA
  • gastrin-binding protein
  • GBP
  • HADH
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), alpha subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
  • LCEH
  • LCHAD
  • long-chain 2-enoyl-CoA hydratase
  • long-chain-3-hydroxyacyl-CoA dehydrogenase
  • MGC1728
  • mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit
  • mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alphasubunit
  • mitochondrial trifunctional enzyme, alpha subunit
  • mitochondrial trifunctional protein, alpha subunit
  • MTPATP-ALPHA
  • TP-alpha
  • trifunctional enzyme subunit alpha, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-62489
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-67330
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-82609
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP1-84915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HADHA Antibody (NBP2-54988) (0)

There are no publications for HADHA Antibody (NBP2-54988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADHA Antibody (NBP2-54988) (0)

There are no reviews for HADHA Antibody (NBP2-54988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HADHA Antibody (NBP2-54988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HADHA Products

Bioinformatics Tool for HADHA Antibody (NBP2-54988)

Discover related pathways, diseases and genes to HADHA Antibody (NBP2-54988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHA Antibody (NBP2-54988)

Discover more about diseases related to HADHA Antibody (NBP2-54988).
 

Pathways for HADHA Antibody (NBP2-54988)

View related products by pathway.

PTMs for HADHA Antibody (NBP2-54988)

Learn more about PTMs related to HADHA Antibody (NBP2-54988).

Blogs on HADHA

There are no specific blogs for HADHA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADHA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHA