HABP2 Antibody (1H4)

Images

 
Immunoprecipitation: HABP2 Antibody (1H4) [H00003026-M01] - Analysis of HABP2 transfected lysate using anti-HABP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HABP2 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: HABP2 Antibody (1H4) [H00003026-M01] - Detection limit for recombinant GST tagged HABP2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HABP2 Antibody (1H4) Summary

Immunogen
HABP2 (NP_004123, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
Specificity
HABP2 (1H4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HABP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot
Application Notes
It has been used for ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.
Publications
Read Publications using H00003026-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HABP2 Antibody (1H4)

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • EC 3.4.21.92
  • Factor seven-activating protease
  • Factor VII-activating protease
  • FSAPfactor VII activating protein
  • HABP
  • Hepatocyte growth factor activator-like protein
  • HGFALhyaluronic acid binding protein 2
  • hyaluronan binding protein 2
  • hyaluronan-binding protein 2
  • PHBPplasma hyaluronan binding protein
  • Plasma hyaluronan-binding protein

Background

The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
1310-SE
Species: Hu
Applications: EnzAct
DSE100
Species: Hu
Applications: ELISA
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
236-EG
Species: Hu
Applications: BA
DTFP10
Species: Hu
Applications: ELISA
AF2338
Species: Hu
Applications: ICC, IP, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-82778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
H00010561-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-91214
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003026-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for HABP2 Antibody (H00003026-M01)(3)


Showing Publications 1 - 3 of 3.
Publications using H00003026-M01 Applications Species
Altmae S, Kallak TK, Friden B, Stavreus-Evers A. Variation in Hyaluronan-Binding Protein 2 (HABP2) Promoter Region is Associated With Unexplained Female Infertility. Reprod Sci. 2010 Nov 22 [PMID: 21098215]
Mambetsariev N, Mirzapoiazova T, Mambetsariev B et al. Hyaluronic Acid binding protein 2 is a novel regulator of vascular integrity. Arterioscler Thromb Vasc Biol;30(3):483-90. 2010 Mar. [PMID: 20042707]
Shimoda H, Nakamura S, Hitoe S et al. Anti-Adipogenic Polyphenols of Water Shield Suppress TNF-?-Induced Cell Damage and Enhance Expression of HAS2 and HAPB2 in Adiponectin-Treated Dermal Fibroblasts. Nat Prod Chem Res Aug 20 2014

Reviews for HABP2 Antibody (H00003026-M01) (0)

There are no reviews for HABP2 Antibody (H00003026-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HABP2 Antibody (H00003026-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HABP2 Products

Bioinformatics Tool for HABP2 Antibody (H00003026-M01)

Discover related pathways, diseases and genes to HABP2 Antibody (H00003026-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HABP2 Antibody (H00003026-M01)

Discover more about diseases related to HABP2 Antibody (H00003026-M01).
 

Pathways for HABP2 Antibody (H00003026-M01)

View related products by pathway.

PTMs for HABP2 Antibody (H00003026-M01)

Learn more about PTMs related to HABP2 Antibody (H00003026-M01).

Blogs on HABP2

There are no specific blogs for HABP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HABP2 Antibody (1H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HABP2
Entrez
OMIM
Uniprot