HAAO Antibody

Images

 
Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human small intestine.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining in human liver and pancreas tissues using anti-HAAO antibody. Corresponding HAAO RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human kidney, liver, small intestine and testis using Anti-HAAO antibody NBP1-85892 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human kidney.
Immunohistochemistry-Paraffin: HAAO Antibody [NBP1-85892] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAAO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AWVKENRGSFQPPVCNKLMHQEQLKVMFVGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQ
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAAO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAAO Protein (NBP1-85892PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAAO Antibody

  • 3-HAO
  • 3-hydroxyanthranilate 3,4-dioxygenase
  • 3-hydroxyanthranilic acid dioxygenase
  • EC 1.13.11.6,3-hydroxyanthranilate oxygenase
  • HAD
  • HAO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
H00006999-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
8050-KM
Species: Hu
Applications: EnzAct
NBP2-45579
Species: Hu, Rt
Applications: IHC, IHC-P
NBP1-87702
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4479
Species: Hu
Applications: IHC
NBP1-79286
Species: Rt
Applications: WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for HAAO Antibody (NBP1-85892) (0)

There are no publications for HAAO Antibody (NBP1-85892).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAAO Antibody (NBP1-85892) (0)

There are no reviews for HAAO Antibody (NBP1-85892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HAAO Antibody (NBP1-85892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAAO Products

Bioinformatics Tool for HAAO Antibody (NBP1-85892)

Discover related pathways, diseases and genes to HAAO Antibody (NBP1-85892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAAO Antibody (NBP1-85892)

Discover more about diseases related to HAAO Antibody (NBP1-85892).
 

Pathways for HAAO Antibody (NBP1-85892)

View related products by pathway.

PTMs for HAAO Antibody (NBP1-85892)

Learn more about PTMs related to HAAO Antibody (NBP1-85892).

Blogs on HAAO

There are no specific blogs for HAAO, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAAO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAAO