HA-1 Antibody

Images

 
Western Blot: HA-1 Antibody [NBP2-87547] - Host: Rabbit. Target Name: HMHA1. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HA-1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human HA-1. Peptide sequence: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HMHA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HA-1 Antibody

  • histocompatibility (minor) HA-1
  • HLA-HA1
  • KIAA0223HA-1
  • minor histocompatibility antigen HA-1
  • minor histocompatibility protein HA-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054922-B01P
Species: Hu, Mu
Applications: WB
NBP1-57531
Species: Hu
Applications: IHC, IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67563
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MSCTC0
Species: Mu, Rt
Applications: ELISA
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
DY417
Species: Mu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-87547
Species: Hu
Applications: WB

Publications for HA-1 Antibody (NBP2-87547) (0)

There are no publications for HA-1 Antibody (NBP2-87547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HA-1 Antibody (NBP2-87547) (0)

There are no reviews for HA-1 Antibody (NBP2-87547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HA-1 Antibody (NBP2-87547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HA-1 Products

Bioinformatics Tool for HA-1 Antibody (NBP2-87547)

Discover related pathways, diseases and genes to HA-1 Antibody (NBP2-87547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HA-1 Antibody (NBP2-87547)

Discover more about diseases related to HA-1 Antibody (NBP2-87547).
 

Pathways for HA-1 Antibody (NBP2-87547)

View related products by pathway.

PTMs for HA-1 Antibody (NBP2-87547)

Learn more about PTMs related to HA-1 Antibody (NBP2-87547).
 

Research Areas for HA-1 Antibody (NBP2-87547)

Find related products by research area.

Blogs on HA-1

There are no specific blogs for HA-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HA-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMHA1