GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free Summary
| Immunogen |
GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV |
| Specificity |
GTP binding protein 1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GTPBP1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free
Background
This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Publications for GTP-binding protein 1 Antibody (H00009567-M01) (0)
There are no publications for GTP-binding protein 1 Antibody (H00009567-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GTP-binding protein 1 Antibody (H00009567-M01) (0)
There are no reviews for GTP-binding protein 1 Antibody (H00009567-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GTP-binding protein 1 Antibody (H00009567-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GTP-binding protein 1 Products
Blogs on GTP-binding protein 1