GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

Western Blot: GTP-binding protein 1 Antibody (1H1) [H00009567-M01] - Analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody (M01), clone 1H1.Lane 1: GTPBP1 transfected lysate(63.4 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: GTP-binding protein 1 Antibody (1H1) [H00009567-M01] - Analysis of GTPBP1 transfected lysate using anti-GTPBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GTPBP1 monoclonal antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 1H1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free Summary

• Immunogen: GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
• Specificity: GTP binding protein 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GTPBP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

• GP1GTP-binding protein 1
• GP-1MGC20069
• G-protein 1
• GTP binding protein 1
• HSPC018

Background

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTPBP1
• Entrez:
  • 9567(Human)
• OMIM:
  • 602245(Human)
• Uniprot:
  • NP_004277(Human)