GTF3A Antibody (1C6)

Images

 
ELISA: GTF3A Antibody (1C6) [H00002971-M08] - Detection limit for recombinant GST tagged GTF3A is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GTF3A Antibody (1C6) Summary

Immunogen
GTF3A (NP_002088 185 a.a. - 274 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE
Specificity
GTF3A (1C6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GTF3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF3A Antibody (1C6)

  • general transcription factor IIIA
  • TFIIIAAP2
  • transcription factor IIIA

Background

The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3166
Species: Hu
Applications: WB, Simple Western, IHC

Publications for GTF3A Antibody (H00002971-M08) (0)

There are no publications for GTF3A Antibody (H00002971-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3A Antibody (H00002971-M08) (0)

There are no reviews for GTF3A Antibody (H00002971-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF3A Antibody (H00002971-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF3A Products

Bioinformatics Tool for GTF3A Antibody (H00002971-M08)

Discover related pathways, diseases and genes to GTF3A Antibody (H00002971-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF3A Antibody (H00002971-M08)

Discover more about diseases related to GTF3A Antibody (H00002971-M08).
 

Pathways for GTF3A Antibody (H00002971-M08)

View related products by pathway.

PTMs for GTF3A Antibody (H00002971-M08)

Learn more about PTMs related to GTF3A Antibody (H00002971-M08).

Blogs on GTF3A

There are no specific blogs for GTF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF3A Antibody (1C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3A
Entrez
OMIM
Uniprot