GTF2H1 Antibody

Images

 
Western Blot: GTF2H1 Antibody [NBP2-38556] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: GTF2H1 Antibody [NBP2-38556] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Analysis in human testis and skeletal muscle tissues using Anti-GTF2H1 antibody. Corresponding GTF2H1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GTF2H1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN
Specificity
Specificity of human GTF2H1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2H1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTF2H1 Protein (NBP2-38556PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTF2H1 Antibody

  • Basic transcription factor 2 62 kDa subunit
  • BTF2 p62
  • BTF2general transcription factor IIH, polypeptide 1 (62kD subunit)
  • General transcription factor IIH polypeptide 1
  • general transcription factor IIH subunit 1
  • general transcription factor IIH, polypeptide 1, 62kDa
  • TFB1
  • TFIIH basal transcription factor complex p62 subunit
  • TFIIH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-67850
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for GTF2H1 Antibody (NBP2-38556) (0)

There are no publications for GTF2H1 Antibody (NBP2-38556).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H1 Antibody (NBP2-38556) (0)

There are no reviews for GTF2H1 Antibody (NBP2-38556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTF2H1 Antibody (NBP2-38556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GTF2H1 Antibody (NBP2-38556)

Discover related pathways, diseases and genes to GTF2H1 Antibody (NBP2-38556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H1 Antibody (NBP2-38556)

Discover more about diseases related to GTF2H1 Antibody (NBP2-38556).
 

Pathways for GTF2H1 Antibody (NBP2-38556)

View related products by pathway.

PTMs for GTF2H1 Antibody (NBP2-38556)

Learn more about PTMs related to GTF2H1 Antibody (NBP2-38556).
 

Research Areas for GTF2H1 Antibody (NBP2-38556)

Find related products by research area.

Blogs on GTF2H1

There are no specific blogs for GTF2H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2H1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H1
Uniprot